KEGG   Mus musculus (house mouse): 66593
Entry
66593             CDS       T01002                                 
Symbol
Diablo, 0610041G12Rik, 1700006L01Rik, AU040403, Smac
Name
(RefSeq) diablo, IAP-binding mitochondrial protein
  KO
K10522  diablo
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    66593 (Diablo)
   04215 Apoptosis - multiple species
    66593 (Diablo)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    66593 (Diablo)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    66593 (Diablo)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     66593 (Diablo)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    66593 (Diablo)
SSDB
Motif
Pfam: Smac_DIABLO Hc1
Other DBs
NCBI-GeneID: 66593
NCBI-ProteinID: NP_075721
MGI: 1913843
Ensembl: ENSMUSG00000029433
UniProt: Q9JIQ3
Position
5:complement(123649393..123664825)
AA seq 237 aa
MAALRSWVTRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPIAQK
SEPQSLSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLG
KMNSQEEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASIT
ARNHIQLVKSQVQEVRQLSQKAETKLAEAQTKELHQKAQEVSDEGADQEEEAYLRED
NT seq 714 nt   +upstreamnt  +downstreamnt
atggcggctctgagaagttgggtgactcggagcgtctgctctctgttcaggtacagacag
cgttttcctgtcttggctaactctaagaaacgctgtttctcagaattgataaaaccatgg
cacaaaactgtgttgactggatttggcatgacactgtgtgcggttcctattgctcagaaa
tcggagcctcagtctctcagtaacgaagcattgatgaggagggctgtgtctttggtaaca
gatagcacctctacctttctgtctcaaaccacctacgcgctgattgaagcaatcaccgag
tatactaaggctgtttacacgttagtgtctctgtaccgacaatatacaagtttacttggg
aagatgaattcccaggaggaagatgaggtgtggcaggtaattataggagccagagttgag
atgacttcaaaacagcaggaatatttgaagttggagaccacttggatgacagcggttggc
ctttcagagatggctgctgaggctgcctatcaaactggagcagatcaggcctccataact
gccaggaatcacatccagttggtgaagtcacaggtacaggaggtgcgccagctctcccag
aaggcagaaaccaagttggctgaagcacagacaaaagagctgcaccagaaagcacaggaa
gtgagtgatgagggggctgaccaggaagaggaggcctacctgcgtgaagattga

DBGET integrated database retrieval system