KEGG   Mus musculus (mouse): 66601
Entry
66601             CDS       T01002                                 

Symbol
Tmigd1, 2010002A20Rik, Tmigd
Name
(RefSeq) transmembrane and immunoglobulin domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set ig V-set Ig_5 C2-set_2 Ig_4 Ig_C17orf99 Izumo-Ig Adeno_E3_CR1
Other DBs
NCBI-GeneID: 66601
NCBI-ProteinID: NP_079931
MGI: 1913851
Ensembl: ENSMUSG00000020839
Vega: OTTMUSG00000006243
UniProt: Q9D7L8
Position
11; 11 B5
AA seq 261 aa
MVWKITGPLQACQLLLVVLSLPQGRTSSVLTVNGRTENYILDTQHGVQASLECAVQNHTE
DEELLWYREDGIVDLKNGNKINISSVCVSPINESDNGVRFTCKLQRDQTVSVTVVLNVTF
PPLLSGNGFQTVEENSDVSLVCNVKSNPQAQMMWYKNNSALVLEKGRHQIHQTRESFQLS
ITKVKKSDNGTYSCIASSSLKMETMDFHLLVKDKVFVMPAEPIIAACVVVVLTMAFALFS
RRKRIMKLCGKKNDPNSETAL
NT seq 786 nt   +upstreamnt  +downstreamnt
atggtgtggaagatcaccgggccactgcaagcatgccagcttctcttagtggttttatct
ttgccacaggggagaacaagctctgttttaactgtgaatggtagaactgagaactatatt
ctggacactcaacatggtgtccaagcatctctggaatgtgctgttcaaaaccacaccgag
gatgaagaacttctctggtacagagaagatggaatagtagatctgaaaaatggaaacaaa
atcaacatcagttctgtttgtgtctctcccatcaacgaaagtgacaatggagtccgcttt
acctgcaagctacagcgcgatcagacggtgtccgttacagtagtgctgaacgttaccttt
cctcctcttctaagtggcaatggcttccaaaccgtggaggaaaacagcgatgtaagtttg
gtttgcaacgtgaaatccaaccctcaagcgcaaatgatgtggtataaaaacaacagcgcc
ttggttttagagaaaggccgtcaccaaatccaccagacaagggagtcttttcagttgtcc
atcaccaaagtcaagaaatctgacaatgggacctacagctgtattgccagctcatctctg
aaaatggagaccatggacttccacctgcttgttaaagacaaagtttttgtcatgccggca
gagcccatcattgctgcttgtgtcgtggtcgtcctgacgatggcttttgccctgttttct
aggaggaaaagaataatgaagctctgtgggaaaaagaatgacccgaattcagaaacagct
ctataa

DBGET integrated database retrieval system