KEGG   Mus musculus (mouse): 66606Help
Entry
66606             CDS       T01002                                 

Gene name
Lrrc57, 2810002D13Rik, AA407405
Definition
(RefSeq) leucine rich repeat containing 57
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_1 LRR_9
Motif
Other DBs
NCBI-GeneID: 66606
NCBI-ProteinID: NP_001153081
MGI: 1913856
Ensembl: ENSMUSG00000027286
Vega: OTTMUSG00000015625
UniProt: Q8JZX5
Position
2; 2 E5
AA seq 264 aa AA seqDB search
MMSQGVPARAEALGARLRELSRGARMGNSALRAHVETAQKTGVFQLKDRGLTEFPSELQK
LTSNLRTIDLSNNKIDSLPPLIIGKFTLLKSLSLNNNKLTVLPDELCNLKKLETLSLNNN
HLRELPSTFGQLSALKTLSLSGNQLGALPPQLCCLRHLDVVDLSKNQIRSIPDTVGELQA
IELNLNQNQISQLSVKISCCPRLKVLRLEENCLELSMLPQSILSDSQICLLAVEGNLFEI
KKLRELEGYDKYMERFTATKKKFA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcacagggcgttcctgcccgggcggaagccctgggagcgcgtctcagggaactg
agccgtggcgctaggatgggtaacagtgctctccgtgctcatgtggaaacagcgcagaaa
actggtgtctttcagcttaaagaccgtggtctgaccgagttcccctcagagttgcagaag
ctgacaagcaatcttaggaccatcgatttatccaacaacaagattgacagcctaccgcct
ctgataataggaaagttcactctgctaaagagcctctccctcaacaacaacaaactgact
gttctacctgatgaattatgcaatctgaaaaaactagagacactaagtctcaacaacaat
cacctgagagagctaccatctacctttgggcagttgtctgccctgaagacgctgagcctc
tctgggaatcagctgggagcattacccccccagctttgttgcctgagacatctagatgta
gtagatctctctaaaaaccagattcggagtatacctgacacagttggggagctgcaggcc
atcgaactcaatctcaaccagaaccagatctctcagctctctgtgaagatatcctgctgt
cctcgcctcaaggtcctccggctggaagagaactgccttgagctcagcatgcttccacag
agcatcctcagtgactcccaaatctgcctgcttgctgtggaaggcaatctctttgaaata
aagaaacttcgagaactagagggttatgataagtacatggagaggttcacagccaccaag
aagaaatttgcatga

DBGET integrated database retrieval system