KEGG   Mus musculus (mouse): 66614
Entry
66614             CDS       T01002                                 

Gene name
Gpatch4, 2610029K21Rik, Gpatc4
Definition
(RefSeq) G patch domain containing 4
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: G-patch
Other DBs
NCBI-GeneID: 66614
NCBI-ProteinID: NP_001104279
MGI: 1913864
Ensembl: ENSMUSG00000028069
Vega: OTTMUSG00000051869
UniProt: Q3TFK5
Position
3; 3 F1
AA seq 415 aa
MSVTPEVKSRGMKFAEEQLLKHGWTQGKGLGRRENGITQALKVTLKQDNHGVGHDPAKEF
TDHWWSDLFNKTAASLVVDSGKDGVQIRRLSKETTQRSHPKPSLLYQKFVKTATLTSGEE
KPDRDLGNCSDVDNHEPTPPKILTDEMLLKACEGRTAHKAARIGITMKAKLARLEAQEQA
FLAQLKGSKALGTSQPLTDSEPSQKKKKKRKQKEGEEAATTEKSLGDELLGHTDRSFRDS
RKKKKRQKAERQGTAIGSEEEEAAGESGPRELSTEQSDQPSRKKKKRRKQRHEEDGEMGV
CDEGGRDVTSRPKAVNSGGDKDPRRSSKKRGTCGEDLDTQEEEGKDDLTKGERKVRRKDK
RKRQQCCEEDLDVSSKDDGGTWVAEDAGERSRQYPKERAKKKKRKRDRGSEVDLS
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgagtgtcaccccagaggtcaagagccgtgggatgaagtttgctgaagagcagctgctg
aagcatggatggactcaaggcaagggcctgggccggagggagaatggcattacccaggcc
ctcaaggtgacactgaagcaagataaccatggggtgggacatgaccctgccaaggaattt
acagaccactggtggagtgatctcttcaacaagactgccgccagcttggtagtggactcg
gggaaggatggagtgcagataagacgtctttccaaggagaccacccagcgcagtcacccc
aaacccagcttgctgtatcagaagtttgtgaagacagccacactaacctcgggtgaggag
aagcctgacagagacttggggaactgcagtgatgttgacaaccatgagcccacgccccca
aagattctgactgatgagatgctactcaaggcttgcgaggggcgaacagcacacaaggct
gcccggattggtatcaccatgaaggccaagcttgctcgcctggaggcccaagagcaggcc
tttctggctcagctcaaaggctcaaaggctctgggcacctctcaaccactgactgacagt
gagccttcccaaaaaaagaaaaagaagaggaagcagaaagagggggaagaggctgcaaca
actgaaaagagtctaggtgacgagctgctgggacacacggacaggagcttcagggacagc
aggaagaagaagaagaggcagaaagccgagagacagggaacggctataggaagtgaggag
gaagaggctgcaggagagagtgggcccagagaactgagcacagagcaatctgatcagcct
tccaggaaaaagaagaaaaggaggaagcagcgccatgaagaagacggggagatgggagtc
tgtgatgaaggaggtagagatgtgacaagccggccaaaggcagtcaacagtggaggagac
aaagaccccaggagaagcagcaagaagcgagggacgtgtggggaggacttagatacccaa
gaggaagaagggaaggatgacctaacaaaaggagagagaaaggtcagaagaaaagacaaa
aggaaaagacagcagtgctgtgaggaggacttagatgtaagcagtaaagatgatggtggg
acatgggtagcagaggatgcaggtgagagaagtcggcaatacccaaaggagagagccaaa
aagaagaagcggaagagggaccgagggtctgaagtggatctcagctga

DBGET integrated database retrieval system