KEGG   Mus musculus (mouse): 666187Help
Entry
666187            CDS       T01002                                 

Gene name
Gm7971
Definition
(RefSeq) predicted gene 7971
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: FTH LRR_4
Motif
Other DBs
NCBI-GeneID: 666187
NCBI-ProteinID: XP_987278
MGI: 3779772
Ensembl: ENSMUSG00000094043
Vega: OTTMUSG00000055682
UniProt: J3QMM8
Position
5 E3; 5
AA seq 481 aa AA seqDB search
MSVQTPSTLQNLTLKALLRDEALALSCLEEVPFLLFPALFKEAFAGRLKKLMKAIVAAWT
FPCLPVGALMKSPNLETLQAVLDGIDMQLTRKSHPRGKLQVLDLRNVHHAFWDIWAGAED
GSCSSESLNEKPTVVKVLRRYARRKQLKVVADLCLRPRRDEAQAYFLKWAQQRKDSLHLC
CINMKIWAMPVDFVLEILNVFHPEHIEEFELNTEWNVFNLARFAPCLGQMRNLRKLLLAP
LYKNVFKIANRTGDREDKCVKEFVSIFSKFNCLQHLSMQGVHFLTDHMSQVFRCLMTPLE
SLSITHYQISQSDLDSFSCCQSLFQLKHLEMKGMVLQVLDVMPLRGLLEKVAKTLETLNL
QGCKLKDSQLNALLPSFIRCSQLTKINLYNNDFSMPILKDLLQQTANWNKMNVEQYPAPL
ECYNELGHVSVERFAQLCQELMDTLRAIRQPKSLSFATRICHKCGEPCVYGQGGRLCFCW
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttcagactccgtccactctccagaatctgacattgaaggctctgctgagagat
gaggctttggccttgtcctgtctggaggaggtgccttttctgctcttcccagctctgttc
aaggaggcctttgctggcagacttaagaagctcatgaaggcaatcgtggcagcctggact
tttccctgtctccctgtgggggctttgatgaagtcacctaacttggagaccttgcaggct
gtgctagatggaatagacatgcaactgacaagaaaatctcaccccaggggaaaacttcag
gttctggacctgaggaatgtgcaccatgccttctgggacatatgggctggtgcagaggat
ggtagctgttcttcagagtccttgaatgagaagcctacagtagtgaaggtccttcgcaga
tatgcacggaggaagcagctgaaggtggtagcagacctgtgcctcaggccccgccgtgat
gaagcacaagcatacttcttgaagtgggcccagcagagaaaggactccctacatttgtgc
tgtataaacatgaagatctgggctatgcccgtggactttgtcttagagattttgaatgtc
tttcatccagagcacatcgaggaattcgaactgaacactgagtggaatgtgtttaatctg
gcccgttttgctccctgcttagggcagatgagaaatcttcgcaaacttctcctggcaccc
ctctataagaatgtcttcaagattgccaataggacaggagacagagaagataagtgtgtc
aaggagttcgtttctatcttctccaaattcaattgtctccagcatctctccatgcaaggt
gtccactttctcacagaccacatgagtcaggtcttcaggtgcttgatgacacccttggag
tccctctccatcactcactaccaaatttcacagtcagacttggattccttctcttgctgt
cagagtctctttcagctaaaacatctggagatgaaaggcatggtcttacaggttttggat
gtgatgcctctgagaggtctcttagagaaagtggcaaaaactcttgagactctgaatttg
cagggatgtaagctgaaggactctcagctcaatgcactcctaccttccttcatacgatgc
tctcagctcaccaagatcaacttgtacaacaatgacttctccatgcccatcctgaaggac
cttttacagcaaacagccaactggaacaagatgaatgtggaacagtaccctgcccctctg
gagtgttataatgagttgggacatgtctctgtagaaagatttgcccaactttgtcaggaa
ctcatggatacactaagggcaataaggcagcccaagagcctctcttttgctacacgtata
tgccacaaatgtggcgagccctgtgtctatggtcaggggggtagactttgtttttgctgg
cggtga

DBGET integrated database retrieval system