KEGG   Mus musculus (mouse): 666279
Entry
666279            CDS       T01002                                 

Gene name
Dspp, D, Dmp, Dmp2, Dmp3, Dpp, Dsp
Definition
(RefSeq) dentin sialophosphoprotein
  KO
K23573  dentin sialophosphoprotein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    666279 (Dspp)
SSDB
Other DBs
NCBI-GeneID: 666279
NCBI-ProteinID: NP_034210
MGI: 109172
Ensembl: ENSMUSG00000053268
Vega: OTTMUSG00000042402
UniProt: E9Q9Z9
Position
5 E5; 5 50.59 cM
AA seq 945 aa
MKMKIIIYICIWATAWAIPVPQLVPLERDIVENSVAVPLLTHPGTAAQNELSINSTTSNS
NDSPDGSEIGEQVLSEDGYKRDGNGSESIHVGGKDFPTQPILVNEQGNTAEEHNDIETYG
HDGVHARGENSTANGIRSQVGIVENAEEAESSVHGQAGQNTKSGGASDVSQNGDATLVQE
NEPPEASIKNSTNHEAGIHGSGVATHETTPQREGLGSENQGTEVTPSIGEDAGLDDTDGS
PSGNGVEEDEDTGSGDGEGAEAGDGRESHDGTKGQGGQSHGGNTDHRGQSSVSTEDDDSK
EQEGFPNGHNGDNSSEENGVEEGDSTQATQDNQKLSPKDTRDAEGGIISQSEACPSGKSQ
DQGIETEGPNKGNKSIITKESGKLSGSKDSNGHQGVELDKRNSPKQGESDKPQGTAEKSA
AHSNLGHSRIGSSSNSDGHDSYEFDDESMQGDDPKSSDESNGSDESDTNSESANESGSRG
DASYTSDESSDDDNDSDSHAGEDDSSDDSSDTDDSDSNGDGDSDSNGDGDSESEDKDESD
SSDHDNSSDSESKSDSSDSSDDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNSSSDSS
DSSSSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSSSSDSSDSS
SSSDSSDSSDSSDSSDSSDSSDSSSSDSSSSSNSSDSSDSSDSSSSSDSSNSSDSSDSSD
SSDSSDSSDSSNSSDSSDSSSSSDSSDSSSSSDSSDSSDSSDSSESSESSDSSNSSDSSD
SSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSD
SSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSDS
KDSSSDSSDGDSKSGNGNSDSNSDSNSDSDSDSEGSDSNHSTSDD
NT seq 2838 nt   +upstreamnt  +downstreamnt
atgaaaatgaagataattatatatatatgcatttgggcaactgcctgggccattccggtt
ccccagttagtaccactggaaagagacattgttgaaaactctgtggctgtgcctcttcta
acacatccaggaactgcagcacagaatgagttatctatcaacagcaccactagcaacagc
aacgactccccagatggcagtgagataggagagcaggtacttagcgaggatggttacaaa
agagatgggaatggctccgagtcaatacatgtaggagggaaggattttcctactcagccc
attttagtaaacgaacaggggaacactgctgaagaacacaatgacatagaaacatacggt
catgatggggtacatgcgagaggagagaacagcacagcaaatggcatcaggagccaggta
ggcatcgttgaaaatgcggaggaagcagagagcagtgtccacggacaggctggtcagaat
acaaaatctggaggtgctagtgatgtaagccagaatggagatgcgacccttgtccaggaa
aatgagcctccagaagctagcatcaagaatagcaccaaccatgaggctggaatacacggg
agtggggttgctacacatgaaacgacgcctcagagagaagggctggggagtgagaaccag
gggactgaggtgacaccaagcatcggggaagatgcaggtttggatgatactgatgggagt
cctagcgggaacggggtagaggaggatgaagatacaggctctggtgatggtgagggtgca
gaagcaggagatggaagggagagccatgatggcactaagggccaggggggccaatctcat
gggggaaacactgaccacagaggtcagagttcagttagtactgaagatgatgattctaaa
gaacaagaaggcttcccaaatggacacaatggagacaacagcagtgaggaaaacggtgtt
gaagaaggcgacagtacccaggcaacgcaggacaaccaaaagctcagccccaaagacacc
cgagatgcagagggtgggatcatcagccagtcagaagcatgtccttctgggaagagccaa
gatcagggaatagaaactgaaggtcccaacaaaggcaacaaaagtattattaccaaagaa
tctgggaaactcagtggaagtaaagatagcaatggacaccaaggagtggagctggacaaa
aggaatagcccaaagcaaggggagtctgacaagcctcaaggcactgctgagaaatcagct
gcccacagtaacctgggacacagcaggataggtagcagcagcaatagtgatgggcatgac
agttacgagttcgatgacgagtccatgcaaggagatgatcccaagagcagcgacgaatct
aacggaagtgacgaaagtgacactaactctgaaagcgccaatgagagtggcagccgtgga
gatgcttcttacacatctgatgaatcaagtgatgatgacaatgacagtgactcacatgcg
ggagaagacgatagcagtgatgactcatctgatacagatgacagtgacagtaatggtgat
ggtgacagtgacagtaatggtgatggtgacagcgagagtgaggacaaggacgaatctgac
agcagtgaccatgacaacagcagtgacagtgagagcaaatcagacagcagtgacagtagt
gacgacagcagtgacagcagcgacagtagtgacagcagtgacagcagtgacagtagtgac
agtagtgacagcagcgacagcagtgacagcagcgacagcaacagtagtagtgacagcagc
gacagcagcagtagtagtgacagcagcgacagcagtgacagcagtgacagcagtgacagc
agcgatagcagtgacagcagtgacagcagtgacagcagcgatagcagtgacagcagtgac
agtagtgacagcagtgacagcagcgacagcagcagtagtagtgacagcagcgacagcagc
agtagtagtgacagcagcgacagcagtgacagcagtgacagcagcgatagcagtgacagc
agtgacagcagcagcagcgacagcagcagcagtagcaacagcagtgacagtagtgacagc
agtgacagcagcagcagcagcgacagcagcaacagcagcgacagcagtgacagtagtgac
agcagtgacagtagtgacagcagtgacagcagcaacagtagtgacagcagcgacagcagc
agtagtagtgacagcagcgacagcagcagtagtagtgacagcagtgacagtagtgacagt
agtgacagcagtgagagcagtgagagcagcgacagcagcaacagcagtgacagcagcgac
agtagtgacagcagtgacagtagcgacagcagcgacagtagtgacagtagcgacagcagt
gacagtagcaacagtagcgacagcagtgacagcagtgacagcagcgacagtagtgacagc
agcaacagtagtgacagcagtgacagtagcgacagtagtgacagcagtgacagcagtgac
agcagcgacagtagtgacagcagtgacagtagtgacagcagcgacagtagtgacagcagt
gacagcagtgacagcagtgacagcagcgacagcagcgacagcagtgacagcagcgacagc
agcgacagcagtgacagcagcgacagcagcaacagcagtgacagcagtgacagtgacagc
aaggatagcagttctgacagcagtgatggtgacagcaagtctggtaatggcaacagtgac
agcaacagtgacagcaacagtgacagtgacagtgacagtgaaggcagtgacagtaaccac
tcaaccagtgatgattag

DBGET integrated database retrieval system