KEGG   Mus musculus (mouse): 66629Help
Entry
66629             CDS       T01002                                 

Gene name
Golph3, 4733401N08Rik, 5730410D03Rik, AW413496
Definition
(RefSeq) golgi phosphoprotein 3
  KO
K15620  golgi phosphoprotein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    66629 (Golph3)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Others
    66629 (Golph3)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    66629 (Golph3)
 Protein recycling
   Rab11 associated proteins
    66629 (Golph3)
 Endosome - Golgi transport
   Rab associated proteins
    66629 (Golph3)
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    66629 (Golph3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GPP34 Peptidase_M15_2
Motif
Other DBs
NCBI-GeneID: 66629
NCBI-ProteinID: NP_079949
MGI: 1913879
Ensembl: ENSMUSG00000022200
UniProt: Q9CRA5
Position
15; 15 A1
AA seq 298 aa AA seqDB search
MTSLTQRSSGLVQRRTEASRNAADKERAAGGGGGSGEDEAQSRRDEQDDDDKGDSKETRL
TLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKV
ICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKN
LVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDKRLLALI
YLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgctgacccagcggagctcgggcctggtgcagcggcgcaccgaggcctcccgg
aacgctgccgacaaggagcgggcggcgggaggcggcggcggcagcggcgaggacgaggcg
cagagccgccgcgacgagcaggacgacgacgacaagggcgactccaaggaaacgcggctg
accctgatggaggaggtgctcctgctgggcctcaaggaccgagagggttacacatcattt
tggaatgactgtatatcatctggattacgtggctgtatgttaattgaattagctttgaga
ggaaggttacagttagaggcttgtggaatgagaagaaaaagtcttttaaccagaaaggtg
atctgtaaatcggatgctccaacaggggatgttcttcttgatgaagctctaaagcatgtt
aaggagactcagcctccagagacagtccagaactggattgagttacttagtggtgagacg
tggaatccattaaaattgcattatcaattaagaaacgtacgggaacgattagctaaaaac
ctggtagaaaagggtgtactgacgacagagaaacagaacttcctcctgtttgacatgacg
acacatcctctcaccaataacaacattaagcagcgtctcatcaagaaggtacaagaagct
gttcttgacaaatgggtaaatgaccctcaccgaatggacaagcgcttgctggccctcatt
tacctagcccatgcctcggatgttttggaaaatgcgtttgctcctcttctggacgagcag
tatgatctagccaccaagagagtacggcagctccttgacttagacccagaagtggagtgt
ctgaaggccaacaccaacgaagttctctgggctgtggtagctgcgtttaccaagtaa

DBGET integrated database retrieval system