KEGG   Mus musculus (mouse): 66632Help
Entry
66632             CDS       T01002                                 

Gene name
Dph6, 5730421E18Rik, Atpbd4
Definition
(RefSeq) diphthamine biosynthesis 6
  KO
K06927  diphthine-ammonia ligase [EC:6.3.1.14]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    66632 (Dph6)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.14  diphthine---ammonia ligase
     66632 (Dph6)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Elongation factors
   Elongation associated factors
    66632 (Dph6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Diphthami_syn_2
Motif
Other DBs
NCBI-GeneID: 66632
NCBI-ProteinID: NP_079951
MGI: 1913882
Ensembl: ENSMUSG00000057147
Vega: OTTMUSG00000014824
UniProt: Q9CQ28
Position
2; 2 E4
AA seq 267 aa AA seqDB search
MRVAALISGGKDSCYNMMQCIAEGHQIVALANLRPDENQVESDELDSYMYQTVGHHAIDL
YAEAMALPLYRRAIRGRSLETGRVYTQCEGDEVEDLYELLKLVKEKEEIEGVSVGAILSD
YQRGRVENVCKRLNLQPLAYLWQRNQEDLLREMIASNIKAIIIKVAALGLDPDKHLGKTL
VEMEPYLLELSKKYGVHVCGEGGEYETFTLDCPLFKKKIVVDSSEAVMHSADAFAPVAYL
RLSRLHLEEKVSSVPADDETANSIHSS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcgcggccctgatcagtggtgggaaggacagctgttacaacatgatgcagtgc
attgctgaggggcatcaaattgttgcattagcaaatctaagaccagatgaaaaccaagtg
gagtcagatgaactggatagctatatgtatcagacagtgggtcaccatgccattgacttg
tatgctgaagcaatggcgctgcccctgtatcgcagagccatcagaggaaggagcttggag
acaggaagagtttatacgcaatgtgaaggtgacgaggttgaagatctctatgaactgttg
aaacttgttaaggaaaaagaagaaatcgaaggggtatcagtaggtgctatactctctgac
tatcaacgtggacgagtagaaaatgtatgtaaacgactcaatctccagcctttagcttat
ctttggcaaagaaaccaggaagatttgctccgagagatgatagcttctaatatcaaggcc
attatcatcaaagtagcagctttgggcttagatcctgataagcatcttgggaaaaccctg
gttgaaatggagccttatcttttagagctttctaagaagtacggtgtccacgtgtgtgga
gaaggtggagagtatgagacattcacgttggactgccctctattcaagaagaagattgtt
gtggactcttcagaagcagtcatgcactcagcggatgcattcgcacctgtggcttatctg
cggctctcccggctgcacttggaagagaaagtgtcgtcagtacctgcggatgatgaaaca
gctaactctatacacagctcttaa

DBGET integrated database retrieval system