KEGG   Mus musculus (house mouse): 666339
Entry
666339            CDS       T01002                                 
Symbol
Muc3
Name
(RefSeq) mucin 3, intestinal
  KO
K22016  mucin-3/17
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    666339 (Muc3)
Membrane trafficking [BR:mmu04131]
 Others
  Mucins
   Membrane bound mucins
    666339 (Muc3)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 666339
NCBI-ProteinID: NP_034973
MGI: 1203527
Ensembl: ENSMUSG00000037390
Position
5:complement(137163772..137202809)
AA seq 4499 aa
MSTRRWVRQTAALCLLAFILHSLPRHIAAENGTTESGSVWDGGGNSTQDDSQETQFRTVL
KTKTTDGENSEAWPRQEYQQRSSSPSTTKAEVTTTADVTTTADVTTTAEITTTSDVTTTA
EITNTDDVTTTGEVTTTADVTTTSDVPTTSEVTSTDDVITTAEVTTTAEMTPTDDVTTTS
EVTTTGDVTTTGDVTITGDLTTTADVTTKADFTTTDDVTTTADGSTTADLTTTAKVTTTD
DVTTTGEITTTSEITTTSDVTTTAEITTTDIVTTTGEVTTTADVTTTSDVTTTSEETPTA
DITTTADLTTTAEVTTTDDVTTTVEITTTSEITTTSDVTTIAEITTTDIVTTTGEVTTTA
DVTTTSDVTTTSEETTTADITTTADLTTTAEITTTDDVTTTVEITTTSDVTTTTEITTTD
IVTTTGEVTTTADVTTASDVTTTSEETPTADITTTADLTTTAEVTTTDDVTTTGEVTTTA
DVTTTSDVTTTSEETTTADVTTTSDVTTTAEITTTDDITSTADVTTTADVTTTSDVPTTS
EETTTADVTTTSDVTTTAEITTTDDITSTADVTTTADVTTTSDVTTTTEENPTADITTTA
DLTTTAEVTTTDDVTTTVEITTTSEITTTSDVTTTAEITTTDIVTTTDEDTTTADVTTTS
DVTTTSEETPTADITTTADLTTTADVTTTSDVTTTSEETTTADVTTTSDVTTTAEITTTD
DITSTADVTTTTNVTTTSDVPTTSEVTSTDDVITTTEVTTTAEIIPTDDVTTTSEVTTTG
DVTTTGDVTMTGDLTTTADVTTTADLTTTDEVTTTADGSTTADLTTTAEVTTTDDVTTTV
QITTTSEITTTSDVTTTAEITTTDNVTTTGEVTTTADVTTTSDVTTTSEETPTADITTTA
DLNTTAEVTTTEDVTTTVEITTTSEITTTSDITTTAEITTTDIVTTTGEVTTTADVTTTN
DVTTTSEETPTADITTTADLTTTAEITTTDDITSTADVTTTTDVTTTSDVPTTSEVTSTD
DVITTTEVTTTAEIIPTDDVTTTSEVTTTGDVTTTGDVTMTGDLTTTADVTTTADLTTTD
EVTTTADGSTTADLTTTAEVTTTDDVTTTVQITTTSEITTTSDVTTTAEITTTDNVTTTG
EVTTTADVTTTSDVTTTSEETPTADITTTADLTTTAEVTTTEDVTTTVEITTTSEITTTS
DITTTAEITTTDIVTTTGEVTTTADVTTTNDVTTTSEETPTADITTTADLTTTAEITTTD
DVTTTGEVTTTADVTTTSDVTTTSEETPTADITTTADLTTTAEITTTDDVTTTGEVTTTA
DVTTTSDITTTSEETPTADITTTADLTTTAEVTTTDDVTTTGEVTTTADVTTTSDITTTS
EETPTADITTTADLTTTAEVTTTDDVTTTVEITTTSEITTTSDVTTTAEITTTDIVTTTG
EVTTTADVTTTSDVTTTSEQTPTADITTTADLTTTAEVTTTDDVTTTVEITTTSEITTTS
DVTTTAEITTTDIVTTTGEVTTTADITTTSDVTTTSEETTTADVTTTTDVTTTSEETTTG
DGKTTTAEITTTDDITTTADVTTTPDVTTTAAVTTTGEITPTDDVTTTSEVTTTGDVTST
GDVTTTGEVTTTAEVTTTADVTTTSDVTTTSEETPTADITTTADLTTTAEVTTTDDVTTT
GEVTTTADVTTTSDTTTTSEETPTADITTTVDLTTTAEVTTTDDVTTTVEITTTSEITTT
SDVTTTAEITTSDIFTTTGEVTTTADITTTSDVTTTSEETPTADITTTADLTTTAEITTT
DDVTTTVEITTTSEITTTSEVTTTPDVTTTSDVTTTSEETPTADITTTADLTTTAEVTTT
DDVTTTVEITTTSEITTTSDVTTTAEITTTDIVTTTGEVTTTVDVTTTNDVTTTSEETPT
ADITTTADLTTTAEVTTTDDVTTTGEVTTTADVTTTSDITTTSEETPTADITTTVDLTTT
VEITTTSEITTTSDVTTTAEITTTDIVTTTGEVTTTADVTTTSDVTTTSEETPTADITTT
ADLTTTAEVTTTDDVTTTVEITTTSEITTTSDVTTTAEITTTDIVTTSGEVTTTADVTTT
SDVTTTSEETTTADVTTTTDVTTTSEETTTGDGTTTTAEITTTDDLTTTADVTTTPDVTT
TAAVTTTAEITPTDDVTTTSEVTTTGDVTTTGEVTTTAEVTTTDDVTTTGDVTTTGDLTT
MADVTTTADFTTTDDVTTTADASTTADLATTAEVTTTDDVTTTVEITTTAEITTTAEVTT
TDDVTTTGEVTTTADVTTTTDVTTTSEVTTTADVTTTNDVTTTAEITTTDDITTTADVTT
TADVTTTSYVPTTSEVTSTDDVTTTAEVTTTAEITPTDDVTTTSEVTTTGDVTTTGDVTM
TCDLTTSADVTTTADFTTTDDVTTKADGSTTADLTTTAEVTTNDDVTTTGELTTTAEITT
TSDVTTTAEITTTDIVTTTGEVTTTADVTTTSDVTTTSEETTTADITTTADLTTTAEVTT
TDDVTTTVEITTTSEITTTSDVTTIAEITTTDIVTTTGEVTTTADVTTTNDVTTTSEETP
TADITTTADLTTTAEVTTTDDVTTTGEVTTTADVTTTSDVTTTSEETPTADITTTADLTT
TAEVTTTDDVTTTVEITTTSEITTTSDVTTTAEITTTDIVTTTGEVTTTADITTTSDVTT
TSEETTTADVTTTTDVTTTSEETTTGDGKTTTAEITTTDDITTTADVTTTPDVTTTAAVT
TTGEITPTDDVTTTSEVTTTGDVTTTGDVTTTGEVTTTAEVTTTDDVTTTGDVTTTGDLT
TTADVTTTAYFTTTDDVTTTADGSTTADLTTTAEVTTTDDVTTTVEITTTAEITTTDDVT
TTGEVTTTADVTTTSDVTTTSEETPTADITTTADLTTTAEVTTTDDVTTTVEITTTSEIT
TTSDVTTTAEITTTDIVTTTGEVTTTADVTTTSDVTTTSEETPTADITTTADLTTTAEVT
TTDDVTTTVEITTTSEITTTSDVTTTAEITTTDIVTTTGEVTTTADVTTTSDVTTTSEET
PTADITTTADLTTTAEVTTTDDVTTTVEITTTAEITTTDDVTTTGEVTTTADVTTTAEVI
TTSDVTTTADVTTMPDFTTTAEVTTTLDVTTNDEVTTTSVVTTTPEITTAGDVTTTSEVT
TSADLTTTPEITTTGDVTTTADVTTTADITTTSDVTTTADVTTTADITTTSDVTTTADVT
TIADLSTTPEITTTGDFSSTTDVTSTGDVTTTADVTTTADVTTTGDVTTTAEVTTTAEVT
TTAEATTTADLNTTPEITTTDDVTTTGDVTITAEVTTTAYVTTTTDFTTTAEVNTTDDVT
TIADLTTTAEVTTTNDVTSTAEITTTADLTTTTEVTTTADFITTGDVTTTADVTTMADVT
TTADVTTADLTTTVDVTTMDDVTTTAEVITSGDVTTTSEVTTTSNLNTTPEITTTIDFTS
TVDVTTTGDVTTTADVTTTSDVTTTSKVTTTGDVTTTADTTSTADVTTTADVITTAEVTT
TADFTNTGDVTTSADVTTTADLTTMPDLTTTAEVTTTADVTTTSEFTTTADVTTTADVTS
TADVTTTAEVTTTGDVTTTADVTNTGDITTIGDVTTTTEITTTAYLTTTLEITTTGEVTS
TADVTTSAEVTTTDEITTTDVVTTTGDVTPTAESTTTDDVTTTSDVTTTGDFTTTADVTT
TAYVTTTPDVTTTVEVTTTADFTTTGVVNTTADVTTTADVTTTSEVTTTADLTTTPEITT
TVDFTSTADVTTTADVITTPEVTTTSDVTTTAEVITTADVTTTADVTTTVEVTTTGDVTI
TADVTTTPEITTTVDFTSTADVTITADVTTTADVTTTSDVTITPDVTTTAEVTTTVEITT
TDDVTTTGEVTTTADVTTTSDVTTTSEETTTADITTTSDVSTTSEVTTTAYVTTTADTTS
TAEVTTTADVTTTADVTTTADVTTTADVTTTVEVTTTGDVTTTADVTTTAEVTTTAEITT
TGDVTTTADVTTTAEVTTTAEITTTGDVTTTADVTTTADVTTTADVTTTIDVTTTADVTT
SAEVTTTADVTTTTEVTTTTEVATTPEPTTTPAPTTTAVNCMNGGFWTGDKCICPNGFGG
DRCENIVNVVNCENGGTWDGLKCQCTSLFYGPRCEELVESVEIEPTVAASVEVSVTVTSQ
EYSEKLQDRKSEEFSNFNKTFTKQMALIYAGIPEYEGVIIKNLSKGSIVVDYDVILKAKY
TPGFENTLDTVVKNLETKIKNATEVQVQDVNNNCSALLCFNSTATKVQNSATVSVNPEET
CKKEAGEDFAKFVTLGQKGDKWFCITPCSAGYSTSKNCSYGKCQLQRSGPQCLCLITDTH
WYSGENCDWGIQKSLVYGLGGAGVAVLLVILVILLVFSIRFRKDAQRQRSRVSEMYKWGE
EEGRASPGTFHNFGFDHNEERENYMPLDSVYNTFQPSLNHINPERKIQIQRPQVVMTSL
NT seq 13500 nt   +upstreamnt  +downstreamnt
atgtcgacgcggaggtgggtgaggcagactgccgcgctctgcctgctggctttcatcctc
cactccctgccccgacacattgctgctgagaatgggaccaccgagagcggaagtgtgtgg
gatggaggaggaaatagcacccaagacgacagccaggagactcagttccggacggtgttg
aagaccaaaaccacagacggggaaaacagtgaggcatggccacggcaggagtaccagcaa
agatccagttccccatccaccacaaaggctgaagtcaccaccactgctgatgtcacaacc
accgctgatgtcacaaccactgccgaaatcacaactacttctgatgtcaccaccactgct
gagatcacaaacactgatgatgtcaccaccacaggtgaagtcaccacaactgctgatgtc
acaaccactagtgatgtccccaccacttctgaagtcaccagcactgatgatgtcatcacc
actgctgaagtcacaaccactgctgaaatgacacccactgatgatgttacaaccacttct
gaagtcaccaccactggtgatgtcacaaccactggtgatgtcacaataactggtgatctc
accacaacggctgatgtaaccaccaaagctgacttcacaaccactgatgatgtcaccaca
acagctgatggctccacaactgctgacctcaccaccactgctaaagtcacaaccactgat
gatgtcaccaccaccggtgaaatcacaaccacttccgaaatcacaaccacttctgatgtt
accaccactgctgaaatcacaaccactgatattgtcaccaccacaggtgaagtcaccaca
actgctgatgtcacaaccactagtgatgtcaccaccacttctgaagagaccccaactgct
gatatcaccacaactgctgacctcaccaccactgctgaagtcacaaccactgatgatgtc
accaccactgtagaaatcacaaccacctctgaaatcacaaccacttctgatgttaccacc
attgctgaaatcacaaccactgatattgtcaccaccacaggtgaagtcaccacaactgct
gatgtcacaaccactagtgatgtcaccaccacttctgaagagaccacaactgctgatatc
accacaactgctgacctcaccaccactgctgaaatcacaaccactgatgatgtcaccacc
actgtagaaatcacaaccacttctgatgttaccaccactactgaaatcacaaccactgat
attgtcaccaccacaggtgaagtcaccacaactgctgatgtcacaaccgctagtgatgtc
accaccacttctgaagagaccccaactgctgatatcaccacaactgctgacctcaccacc
actgctgaagtcacaaccactgatgatgtcaccaccacaggtgaagtcaccacaactgct
gatgtcacaaccactagtgatgtcaccaccacttctgaagagaccacaactgctgatgtc
acaaccacttctgatgttaccaccactgctgaaatcacaaccactgatgatatcaccagt
acggctgatgtcaccacaactgctgatgtcacaaccactagtgatgtccccaccacttct
gaagagaccacaactgctgatgtcacaaccactagtgatgtcaccaccactgctgaaatc
acaaccactgatgatatcaccagtacggctgatgtcaccacaactgctgatgtcacaacc
actagtgatgtcaccaccactactgaagagaacccaactgctgatatcaccacaactgct
gacctcaccaccactgctgaagtcacaaccactgatgatgtcaccaccactgtagaaatc
acaacaacttccgaaatcacaaccacttctgatgttaccaccactgctgaaatcacaacc
actgatattgtcaccaccacagatgaagacaccacaactgctgatgtcacaaccactagt
gatgtcaccaccacttctgaagagaccccaactgctgatatcaccacaactgctgacctc
accaccactgctgatgtcacaaccactagtgatgtcaccaccacttctgaagagaccaca
actgctgatgtcacaaccactagtgatgtcaccaccactgctgaaatcacaaccactgat
gatatcaccagtacggctgatgtcaccacaactactaatgtcacaaccactagtgatgtc
cccaccacttctgaagtcacgagcactgatgatgtcatcaccactactgaagtcacaacc
actgctgaaatcatacccactgatgatgttacaaccacttctgaagtcaccaccactggt
gatgtcacaaccactggtgatgtcacaatgactggtgatctcaccacaacggctgatgtc
accaccacagctgacttgacaaccactgatgaggtcaccacaacagctgatggctccaca
actgctgacctcaccaccactgctgaagtcacaaccactgatgatgtcacaaccactgta
caaatcacaacaacttccgaaatcacaaccacttctgatgttaccaccactgctgaaatc
acaaccactgataatgtcaccaccacaggtgaagtcaccacaactgctgatgtcacaacc
actagtgatgtcaccaccacttctgaagagaccccaactgctgatatcaccacaactgct
gacctcaacaccactgctgaagtcacaaccactgaagatgtcaccaccactgtagaaatc
acaaccacttccgaaatcacaaccacttctgatattaccaccactgctgaaatcacaacc
actgatattgtcaccaccacaggtgaagtcaccacaactgctgatgtcacaaccactaat
gatgtcaccaccacttctgaagagaccccaactgctgatatcaccacaactgctgacctc
accaccactgctgaaatcacaaccactgatgatatcaccagtacggctgatgtcaccaca
actactgatgtcacaaccactagtgatgtccccaccacttctgaagtcacgagcactgat
gatgtcatcaccactactgaagtcacaaccactgctgaaatcataccgactgatgatgtt
acaaccacttctgaagtcaccaccactggtgatgtcacaaccactggtgatgtcacaatg
actggtgatctcaccacaacggctgatgtcaccaccacagctgacttgacaaccactgat
gaggtcaccacaacagctgatggctccacaactgctgacctcaccacaactgctgaagtc
acaaccactgatgatgtcacaaccactgtacaaatcacaacaacttccgaaatcacaacc
acttctgatgttaccaccactgctgaaatcacaaccactgataatgtcaccaccacaggt
gaagtcaccacaactgctgatgtcacaaccactagtgatgtcaccaccacttctgaagag
accccaactgctgatatcaccacaactgctgacctcaccaccactgctgaagtcacaacc
actgaagatgtcaccaccactgtagaaatcacaaccacttccgaaatcacaaccacttct
gatattaccaccactgctgaaatcacaaccactgatattgtcaccaccacaggtgaagtc
accacaactgctgatgtcacaaccactaatgatgtcaccaccacttctgaagagacccca
actgctgatatcaccacaactgctgacctcaccaccactgctgaaatcacaaccactgat
gatgtcaccaccacaggtgaagtaaccacaactgctgatgtcacaaccactagtgatgtc
accaccacttctgaagagaccccaactgctgatatcaccacaactgctgacctcaccacc
actgctgaaatcacaaccactgatgatgtcaccaccacaggtgaagtcaccacaactgct
gatgtcacaaccactagtgatatcaccaccacttctgaagagaccccaactgctgatatc
accacaactgctgacctcaccaccactgctgaagtcacaaccactgatgatgtcaccacc
acaggtgaagtcaccacaactgctgatgtcacaaccactagtgatatcaccaccacttct
gaagagaccccaactgctgatatcaccacaactgctgacctcaccaccactgctgaagtc
acaaccactgatgatgtcaccaccactgtagaaatcacaaccacttccgaaatcacaacc
acttctgatgttaccacaactgctgaaatcacaaccactgatattgtcaccaccacaggt
gaagtcaccacaactgctgatgtcacaaccactagtgatgtcaccaccacttctgaacag
accccaactgctgatatcaccacaactgctgacctcaccaccactgctgaagtcacaacc
actgatgatgtcaccaccactgtagaaatcacaaccacctctgaaatcacaaccacttct
gacgttaccaccactgctgaaatcacaaccactgatattgtcaccaccacaggtgaagtc
accacaactgctgatatcacaaccactagtgatgtcaccaccacttctgaagagaccaca
actgctgatgtcacaaccactactgatgtcaccaccacttctgaagagaccacaactggt
gatggcaaaaccaccactgctgaaatcacaaccactgatgatatcactactacggctgat
gtcaccacaactcctgatgtcaccaccactgctgcagtcacaaccactggtgaaatcaca
cccactgatgatgttacaaccacttctgaagtcaccaccactggtgatgtcacaagcact
ggtgatgtcaccaccactggtgaagtgaccaccactgctgaagtcaccacaactgctgat
gtcacaaccactagtgatgtcaccaccacttctgaagagaccccaactgctgatatcacc
acaactgctgacctcaccaccactgcagaagtcacaacgactgatgatgtcaccaccaca
ggtgaagtcaccacaactgctgatgtcacaaccactagtgataccaccaccacttctgaa
gagaccccaactgctgatatcaccacaactgttgacctcaccaccactgctgaagtcaca
accactgatgatgtcaccaccactgtagaaatcacaaccacttccgaaatcacaaccact
tctgatgttaccaccactgctgaaatcacaacctctgatattttcaccaccacaggtgaa
gtcaccacaactgctgatatcacaaccactagtgatgtcaccaccacttctgaagagacc
ccaactgctgatatcaccacaactgctgacctaaccaccactgctgaaatcacaaccact
gatgatgtcaccaccactgtagaaatcacaaccacttccgaaatcacaaccacttctgaa
gtcaccacaactcctgatgtcacaaccactagtgatgtcaccaccacttctgaagagacc
ccaactgctgatatcaccacaactgctgacctcacaaccactgctgaagtcacaaccact
gatgatgtcaccaccactgtagaaatcacaaccacttccgaaatcacaaccacttctgat
gtcaccaccactgctgaaatcacaaccactgatattgtcaccaccacaggtgaagtcacc
acaactgttgatgtcacaaccactaatgatgtcaccaccacttctgaagagaccccaact
gctgatatcaccacaactgctgacctcaccaccactgcagaagtcacaacgactgatgat
gtcaccaccacaggtgaagtcaccacaactgctgatgtcacaaccactagtgatatcacc
accacttctgaagagaccccaactgctgacatcaccacaactgttgacctcaccaccact
gtagaaatcacaaccacttccgaaatcacaaccacttctgatgttaccaccactgctgaa
atcacaaccactgatattgtcaccaccacaggtgaagtcaccacaactgctgatgtcaca
accactagtgatgtcaccaccacttctgaagagaccccaactgctgatatcaccacaact
gctgacctcaccaccactgctgaagtcacaaccactgatgatgtcaccaccactgtagaa
ataacaaccacctctgaaatcacaaccacttctgatgttaccaccactgctgaaatcaca
accactgatattgtcaccacctcaggtgaagtcaccacaactgctgatgtcacaaccact
agtgatgtcaccaccacttctgaagagaccacaactgctgatgtcacaaccactactgat
gtcaccaccacttctgaagagaccacaactggtgatggcacaaccaccactgctgaaatc
acaaccactgatgatctcactactacggctgatgtcaccacaactcctgatgtcaccacc
actgctgcagtcacaaccactgctgaaatcacacccactgatgatgttacaaccacttct
gaagtcaccaccactggtgatgtcacaaccactggtgaagtgaccaccactgctgaagtc
accacaactgatgatgtcacaaccactggtgatgtcaccacgactggtgatctcaccaca
atggctgatgtcaccaccacagctgacttcacaaccactgatgatgtcaccacaacagct
gatgcctccacaactgctgacctcgccaccactgctgaagtcacaaccactgatgatgtc
accaccactgtagaaatcacaaccactgctgaaatcacaaccactgctgaagtcacaacc
actgatgatgtcaccaccacaggtgaagtcaccacaactgctgatgtcacaaccactact
gatgtcaccaccacttctgaagtgaccacaactgctgatgtcacaaccactaatgatgtc
accaccactgctgaaatcacaaccactgatgatatcaccactacggctgatgtcaccaca
actgctgatgtcacaaccactagttatgtccccaccacttctgaagtcaccagcactgat
gatgtcaccaccactgctgaagtcacaaccactgctgaaatcacacccactgatgatgtt
acaaccacttctgaagtcaccaccactggtgatgtcacaaccactggtgatgtcacaatg
acttgtgatctcaccacatcggctgatgtcaccaccacagctgactttacaaccactgat
gatgtcaccacaaaagctgatggctccacaactgctgacctcaccaccactgctgaagta
acaaccaatgatgatgtcaccaccaccggtgaactcacaaccactgctgaaatcacaacc
acttctgatgttaccaccactgctgaaatcacaaccactgatattgtcaccaccacaggt
gaagtcaccacaactgctgatgtcacaaccactagtgatgtcaccaccacttctgaagag
accacaactgctgatatcaccacaactgctgacctcaccaccactgctgaagtcacaacc
actgatgatgtcaccaccactgtagaaatcacaaccacctctgaaatcacaaccacttct
gatgttaccaccattgctgaaatcacaaccactgatattgtcaccaccacaggtgaagtc
accacaactgctgatgtcacaaccactaatgatgtcaccaccacttctgaagagacccca
actgctgatatcaccacaactgctgacctcaccaccactgctgaagtcacaaccactgat
gatgtcaccaccacaggtgaagtcaccacaactgctgatgtcacaaccactagtgatgtc
accaccacttctgaagagaccccaactgctgatatcaccacaactgctgacctcaccacc
actgctgaagtcacaaccactgatgatgtcaccaccactgtagaaatcacaaccacctct
gaaatcacaaccacttctgatgttaccaccactgctgaaatcacaaccactgatattgtc
accaccacaggtgaagtcaccacaactgctgatatcacaaccactagtgatgtcaccacc
acttctgaagagaccacaactgctgatgtcacaaccactactgatgtcaccaccacttct
gaagagaccacaactggtgatggcaaaaccaccactgctgaaatcacaaccactgatgat
atcactactacggctgatgtcaccacaactcctgatgtcaccaccactgctgcagtcaca
accactggtgaaatcacacccactgatgatgttacaaccacttctgaagtcaccaccact
ggtgatgtcacaaccactggtgatgtcaccaccactggtgaagtgaccaccactgctgaa
gtcaccacaactgatgatgtcacaaccactggtgatgtcaccacgactggtgatctcacc
acaacggctgatgtcaccaccacagcttacttcacaaccactgatgatgtcaccacaaca
gctgatggctccacaactgctgacctcaccaccactgctgaagtcacaaccactgatgat
gtcaccaccactgtagaaatcacaaccactgctgaaatcacaaccactgatgatgtcacc
accacaggtgaagtcaccacaactgctgatgtcacaaccactagtgatgtcaccaccact
tctgaagagaccccaactgctgatatcaccacaactgctgacctcaccaccactgctgaa
gtcacaaccactgatgatgtcaccaccactgtagaaatcacaaccacttccgaaatcaca
accacttctgatgttaccaccactgctgaaatcacaaccactgatattgtcaccaccaca
ggtgaagtcaccacaactgctgatgtcacaaccactagtgatgtcaccaccacttctgaa
gagaccccaactgctgatatcaccacaactgctgacctcaccaccactgctgaagtcaca
accactgatgatgtcaccaccactgtagaaatcacaaccacttccgaaatcacaaccact
tctgatgttaccaccactgctgaaatcacaaccactgatattgtcaccaccacaggtgaa
gtcaccacaactgctgatgtcacaaccactagtgatgtcaccaccacttctgaagagacc
ccaactgctgatattaccacaactgctgacctcaccaccactgctgaagtcacaaccact
gatgatgtcaccaccactgtagaaatcacaaccactgctgaaatcacaaccactgatgat
gtcaccaccacaggtgaagtcaccacaactgctgatgtcaccaccacggctgaagtcata
accacttctgatgtcaccactactgctgatgtcaccacaatgcctgatttcaccaccacg
gctgaagtcaccaccactcttgatgtcaccaccaatgatgaagtcaccaccacttctgta
gtcaccaccacgcctgaaatcacaaccgctggtgatgtcaccaccacttctgaagtcacc
accagtgctgacctcaccaccacacctgaaatcacaaccactggtgatgtaaccaccacc
gctgatgttaccacaactgcagatatcacaaccactagtgatgtcaccaccactgctgat
gtcaccacaactgcagatatcacaaccactagtgatgtcaccaccactgctgatgtcacc
actattgctgacctatcaaccacacctgaaatcacaaccactggtgatttcagcagcaca
actgatgtcacctcgacaggtgatgtaaccacaactgctgatgtcacaaccactgctgat
gtcaccactactggtgatgtcacaaccactgcagaagtaaccaccactgctgaagtcaca
accactgctgaagccaccacaactgctgacctcaacaccacacctgaaatcacaaccact
gatgatgtcaccaccactggtgatgtcaccatcactgctgaagtaaccaccactgcatat
gttaccacaacgactgatttcaccactactgctgaggtcaacaccactgatgatgtcacc
acaatagctgacctcaccaccactgctgaagtcacaaccactaatgatgtcacctctact
gctgaaatcaccacgactgctgacctcaccaccactactgaagtcacaaccactgctgat
ttcatcaccactggtgatgtcaccaccactgcagatgtcaccaccatggctgatgtcacc
actacagctgatgtcacaactgctgacctcaccaccactgttgatgtcaccactatggat
gatgtcaccacaactgctgaagtcataaccagtggtgatgtcaccaccacttctgaggtc
accaccacctctaacctcaacaccacacctgaaatcacaaccactattgatttcaccagc
accgttgatgtcaccaccacaggtgatgtcaccacaactgctgatgtcacaaccactagt
gatgtcaccaccacttctaaagtcaccaccactggtgatgtcaccaccactgctgatacc
acctccactgctgatgtcacaaccactgctgatgtcatcaccactgctgaagtcacaacc
actgctgacttcaccaacactggtgatgtcaccaccagtgctgatgtcaccaccactgca
gatctcaccacaatgcctgatttaaccactactgctgaagtcaccaccacagctgatgtc
accaccacttctgagttcaccaccactgctgatgtcaccacaactgctgatgtcacctcc
actgctgatgtcactaccactgctgaagtcaccaccactggtgatgtcaccaccactgct
gatgtcacaaacactggtgatatcaccacaataggtgatgtcaccacaactactgaaatc
accaccactgcctacctcactaccacacttgaaatcacaaccactggtgaagtcaccagt
actgctgatgtcaccaccagtgctgaagtcacaaccactgatgaaatcacaaccactgat
gtagtcacaaccactggtgatgtcacacccactgctgaaagcacaaccactgatgatgtc
acaaccacttctgatgttaccaccactggtgatttcaccaccactgctgatgtcaccaca
actgcttatgtcacaaccactcctgatgtcaccaccactgttgaagtcacaaccactgct
gacttcaccaccactggtgttgtcaacaccactgctgatgtcaccaccacagctgatgtc
accaccacttctgaggtcaccaccactgctgacctcaccaccactcctgaaattacaacc
actgttgatttcaccagcaccgctgatgtcaccacaactgctgatgtcatcaccactcct
gaagtcacaaccactagtgatgtcaccaccactgctgaagtaatcaccactgctgatgtc
accaccactgctgatgtcaccaccactgttgaagtcacaaccactggtgatgtcaccatc
actgctgatgtcaccaccacacctgaaatcacaaccaccgttgatttcaccagcaccgct
gatgtcaccatcactgctgatgtcaccacaacagctgatgtcacaaccactagtgatgtc
accatcactcctgatgtcaccaccactgctgaagtcaccaccactgtagaaatcacaacc
actgatgatgtcaccaccacaggtgaagtcaccacaactgctgatgtcacaaccactagt
gatgtcaccaccacttctgaagagaccacaactgctgatatcacaaccactagtgatgtt
tccaccacttctgaagtcacaaccactgcttatgtcaccaccactgctgataccacctcc
actgctgaagtcacaaccactgctgatgtcacaaccactgctgatgtcaccaccactgct
gatgttaccaccactgctgatgtcaccaccactgttgaagtcacaaccactggtgatgtc
accaccactgctgatgtcaccaccactgctgaagtcacaaccactgctgaaatcacaacc
actggtgatgtcaccaccactgctgatgtcaccaccactgctgaagtcacaaccactgct
gaaatcacaaccactggtgatgtcaccaccactgctgatgtcaccaccactgcagatgtc
accacaacagctgatgtcacaaccactattgatgtcaccacaacggccgatgtcaccact
tctgctgaagtaaccaccactgctgatgtcaccaccactactgaagttacaaccactaca
gaagttgccaccactcctgagcccactaccaccccagcacctaccactactgccgtgaat
tgtatgaacggagggttctggacaggtgacaagtgcatctgccccaacggcttcgggggg
gatcgctgtgagaatatagtcaacgtggtcaactgcgagaatggaggcacgtgggacggg
ctcaaatgtcagtgcaccagcctcttctatgggccacggtgtgaggaactggtggagagc
gtagagatagagccgacagtcgccgcgtccgtggaagtgagtgtgacagtaaccagtcaa
gaatacagtgagaagctacaggaccgaaagtctgaagaattcagtaacttcaataagaca
ttcacaaaacagatggctctgatttatgctggcataccggagtatgaaggggttatcatc
aaaaatctgagcaaaggcagtatcgtggtggattatgatgtcatcctgaaggccaagtac
accccaggatttgaaaacacattagataccgtcgtcaaaaacctggagacaaaaatcaag
aacgcaacagaagttcaagtacaagatgtcaataataactgttcagctttactgtgtttc
aactccactgccaccaaggtgcaaaacagtgccacagtcagtgtcaatcctgaggagaca
tgcaagaaggaggctggagaggactttgcaaagtttgtcacactggggcagaagggcgat
aagtggttctgtatcacgccttgctctgcgggctacagcacctccaagaactgcagctac
ggcaaatgtcagctgcagcgaagtggaccccagtgcctctgcctgatcacggatactcac
tggtacagcggggaaaactgcgactggggcatccagaaaagcctggtgtatggacttggg
ggagccggcgtggcagtgctgttggtgatcctcgtgatcctcctcgtgttctccatccgc
ttcagaaaagatgcgcaaaggcaacggtccagagtgtctgagatgtacaagtggggtgaa
gaggaaggcagagcatctcccggaaccttccacaactttggttttgaccacaatgaagaa
cgagaaaactacatgcccctggactctgtgtacaacaccttccagccttccctaaaccac
ataaacccagaaagaaagatccagattcagaggccccaggtagtcatgacatcgttgtaa

DBGET integrated database retrieval system