KEGG   Mus musculus (mouse): 66637Help
Entry
66637             CDS       T01002                                 

Gene name
Tsen15, 5730449L18Rik, AL023077, Sen15
Definition
(RefSeq) tRNA splicing endonuclease subunit 15
  KO
K15324  tRNA-splicing endonuclease subunit Sen15
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    66637 (Tsen15)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic Type
  tRNA spricing factors
   tRNA splicing endonucleases
    66637 (Tsen15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sen15
Motif
Other DBs
NCBI-GeneID: 66637
NCBI-ProteinID: NP_079953
MGI: 1913887
Ensembl: ENSMUSG00000014980
Vega: OTTMUSG00000034856
UniProt: Q8R3W5 G3X8S8
Position
1; 1 G2
AA seq 168 aa AA seqDB search
MEERSDSKPTPGCSGPGPAPVRDGGGAHTWAPEDAWMGTHPKYLEMMELDIGDATQVYIA
FLVYLDLMESKSWHEVNCVGIPELQLICLLGTEIEGEGLQTVVPTPISASLSHNRIREIL
KASRKLQGDPELPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcgcagcgattccaaacctaccccgggatgtagcgggcctggcccggctccc
gttcgcgatggcggcggcgcccacacatgggctccggaggacgcctggatgggcacacac
cctaagtatttagaaatgatggaattagatataggagatgccacccaagtttatatagca
ttcttggtttacctggatctcatggagagtaaaagttggcatgaagtaaactgtgtagga
ataccagaactacaactcatctgcctccttggcactgagatcgaaggggaagggctgcag
acggtggtgcctacacccatttctgcttccctcagccataataggataagggaaatcttg
aaggcgtctagaaagttgcaaggcgatccagaactgccgatgtcttttactttggccata
gtggagtcagattccacaatagtctattataaacttaccgatggatttatgctgccagac
cctcagaatatttctcttagaagatga

DBGET integrated database retrieval system