KEGG   Mus musculus (house mouse): 66641
Entry
66641             CDS       T01002                                 
Symbol
Sike1, 2810005O12Rik, 5730470L24Rik, AI450236, AI839862, Sike, Sikeb
Name
(RefSeq) suppressor of IKBKE 1
  KO
K12656  suppressor of IKK-epsilon
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    66641 (Sike1)
SSDB
Motif
Pfam: SIKE Herpes_BLRF2 TSC22 DUF4250
Other DBs
NCBI-GeneID: 66641
NCBI-ProteinID: NP_079955
MGI: 1913891
Ensembl: ENSMUSG00000027854
UniProt: Q9CPR7
Position
3:102903056..102911230
AA seq 207 aa
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGAVLPEQYQEDASD
VKDMSKYKPHILLSQENTQIRDLQQENRELWVSLEEHQDALELIMSKYRKQMLQLMVAKK
AVDAEPVLKAHQSHSAEIESQIDRICEMGAVMRRAVQVDDNQFCKVQERLAQLELENKEL
RELLSISSESLQVGKESSVAPASQTIK
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagctgcacgatcgagaagatcttgacggacgccaagacgctgctggagcggctgcgc
gagcacgatgcggcggccgagtcgctggtggaccagtcggctgcgctgcaccggcgggtg
gcggcgatgcgggaggcgggcgccgtgttacccgagcagtatcaagaggatgcatccgac
gtgaaggacatgtctaaatataaacctcacattctgctgtctcaagagaatacccagatt
agagacttacagcaggaaaacagagaactgtgggtttccttggaggagcaccaggatgcg
ttggaactgatcatgagcaagtaccggaaacagatgttacagttaatggtcgctaagaaa
gccgtggatgccgaaccagttctgaaagctcaccagtctcactctgcagagattgaaagt
cagatcgatagaatctgtgaaatgggagcagtgatgcggagagctgttcaggtggacgat
aaccaattctgtaaggttcaggagagactagctcagctggagcttgaaaataaggaactt
cgagagttactgtccatcagcagtgaatctctgcaggttggaaaagaaagctctgtggct
cctgcctctcagaccatcaagtaa

DBGET integrated database retrieval system