KEGG   Mus musculus (mouse): 66646Help
Entry
66646             CDS       T01002                                 

Gene name
Rpe, 2810429B02Rik, 5730518J08Rik
Definition
(RefSeq) ribulose-5-phosphate-3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00030  Pentose phosphate pathway
mmu00040  Pentose and glucuronate interconversions
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
Module
mmu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mmu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    66646 (Rpe)
   00040 Pentose and glucuronate interconversions
    66646 (Rpe)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     66646 (Rpe)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C OMPdecase IGPS His_biosynth
Motif
Other DBs
NCBI-GeneID: 66646
NCBI-ProteinID: NP_079959
MGI: 1913896
Ensembl: ENSMUSG00000026005
Vega: OTTMUSG00000021851
UniProt: Q8VEE0
Position
1; 1 C3
AA seq 228 aa AA seqDB search
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPTLDIEVDGGVGP
DTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgggctgcaagatcggcccgtccatcctcaacagcgacctggccaacctgggg
gccgagtgcctgcgcatgctggactcgggggccgactacctgcacctggatgtaatggac
gggcattttgttcccaatatcacttttggtcaccctgtggttgaaagcctccgaaagcag
ctaggccaggaccctttctttgatatgcacatgatggtgtctaggccagaacagtgggta
aaaccaatggctgtggcaggtgccaatcaatatacctttcatcttgaggcaactgagaac
ccaggggctttgattaaagacatccgggagaatgggatgaaggttggccttgccatcaaa
ccaggaactacagttgaatatttggccccatgggctaatcaaatagatatggccttggta
atgaccgtagaacctgggtttggagggcagaaattcatggaagacatgatgcccaaggtt
cactggttgaggacccagtttccaactttggatatagaggtcgatggcggagtaggtcct
gacactgttcagaagtgtgcggaggcaggagctaacatgattgtgtctggcagtgccatt
atgaggagtgatgaccccagagctgttatcaacttactaagaaacgtttgctcagaagcg
gctcagaaacgttcccttgatcgatga

DBGET integrated database retrieval system