KEGG   Mus musculus (house mouse): 66648
Entry
66648             CDS       T01002                                 
Symbol
Tpgs2, 5730437P09Rik, 5730494M16Rik, Pgs2
Name
(RefSeq) tubulin polyglutamylase complex subunit 2
  KO
K16605  tubulin polyglutamylase complex subunit 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    66648 (Tpgs2)
   04812 Cytoskeleton proteins [BR:mmu04812]
    66648 (Tpgs2)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  Tubulin polyglutamylase and associated proteins
   66648 (Tpgs2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Tubulin modification proteins
     Tubulin polyglutamylase complex components
      66648 (Tpgs2)
SSDB
Motif
Pfam: SMI1_KNR4
Other DBs
NCBI-GeneID: 66648
NCBI-ProteinID: NP_001004361
MGI: 1913898
Ensembl: ENSMUSG00000024269
Position
18:complement(25260280..25301990)
AA seq 296 aa
MEETTPPLQAGSKPHLEKLTLGVTRILESSPGVTEVSIIEKLPAERHMISSWEQKNNCVM
PEDVRNFYLMTNGFHMTWSVKLDEHIIPLGSMVINGISKLTQLIQSSVYSLPNAPTLADL
EDDTQEGNEDHQLEKPHFDCRSAIFELDSCNGNGKVCLVYKNGKPGLAHDTEIWFLDRAL
YWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKPITYNTSLLTEESD
NFVNKLDPSKVFKSKNKILIPKKKGPVPPASGQKGPGPLPPPTSKPTTGSGNPVRK
NT seq 891 nt   +upstreamnt  +downstreamnt
atggaggagacaacgcccccactgcaagccggcagcaagccgcaccttgagaagttgacc
ctaggcgtcactcgcatcctggaatcttccccaggtgtgaccgaggtgagcataatagaa
aagctgcctgctgagcgtcatatgatttcttcatgggaacagaaaaacaattgtgtgatg
cctgaggatgtgagaaacttctacttgatgaccaatggttttcacatgacctggagtgtg
aagctagatgagcacattattccactgggaagcatggtgattaacggcatttcaaaactg
actcagctcatccagtcttctgtgtactcacttcctaatgcaccaactctggcagaccta
gaggacgatactcaagaaggaaatgaagaccaccagctagagaagcctcactttgactgt
cgcagtgcaatatttgagctggattcatgcaatgggaatgggaaagtttgcctcgtctac
aaaaatgggaaacctgggttagctcatgacactgagatatggttcctggacagagcatta
tactggcactttctcacggatacctttaccgcctattaccgcctgctcatcacccacctg
ggcctgccccagtggcagtatgcctttaccagctatggcattagcccacaggccaagcaa
tggttcagtatgtacaaacccatcacctacaacacaagcctgctcacagaagagtccgac
aactttgtgaacaagctagaccccagcaaagtgttcaagagcaagaacaagattttaatc
ccaaaaaagaaagggcctgtaccacctgccagtggtcagaaagggcctgggcccttacct
cctcctacctctaagcctaccacaggctctggaaatcctgtccgaaaataa

DBGET integrated database retrieval system