KEGG   Mus musculus (mouse): 66663
Entry
66663             CDS       T01002                                 

Gene name
Uba5, 5730525G14Rik, AW240750, Ube1dc1
Definition
(RefSeq) ubiquitin-like modifier activating enzyme 5
  KO
K12164  ubiquitin-like modifier-activating enzyme 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    66663 (Uba5)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   66663 (Uba5)
SSDB
Motif
Pfam: ThiF UDPG_MGDP_dh_N Pox_A_type_inc FAD_binding_3 ApbA 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 66663
NCBI-ProteinID: NP_079968
MGI: 1913913
Ensembl: ENSMUSG00000032557
Vega: OTTMUSG00000027430
UniProt: Q8VE47
Position
9; 9 F1
AA seq 403 aa
MADSVERLRQRVEELEQELARERTRRSGGDGHCGRTRIQEMSDEVLDSNPYSRLMALKRM
GIVSDYKKIRTYAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPYQ
AGLSKVHAAEHTLRNINPDVLFEVHNYNITTVEHFEHFMNRISNGGLEEGQPVDLVLSCV
DNFEARMAINTACNELGQTWMESGVSENAVSGHIQLMIPGESACFACAPPLVVASNIDEK
TLKREGVCAASLPTTMGVVAGILVQNVLKFLLKFGTVSFYLGYNAMQDFFPTMFMKPNPQ
CDDKNCRKQQEEYKKRAAALPTQEAEPQEEAEVVHEDNEWGIELVSEVSEEELKNSSGPV
PTLPEGITVAYTVPKKTEDSASEVTVEDSGESLEDLMARMKNM
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggccgactcggtggagcggctgcgacagcgggttgaggagctggagcaggaactcgcc
cgggagagaacccggcgctctggaggggacggccactgcggccggacccgcatccaggag
atgagcgacgaggtgttggattccaatccctacagccgtctgatggcattgaaacggatg
ggaattgtcagtgactataagaaaatccgtacctacgctgtagcaatagtaggtgttggt
ggagttggtagtgtgactgctgaaatgctgacaagatgtggcattggtaagctgctgctc
tttgactatgataaggtggagctggccaacatgaatcggcttttcttccagccatatcaa
gcaggactgagtaaggtccacgcagcagaacacaccctgaggaacattaaccctgatgtt
ctgtttgaagtccacaactacaatatcaccacagtggaacactttgaacatttcatgaat
agaataagtaatggtggattagaagaaggacaacctgttgacctagttcttagctgtgtg
gacaactttgaagctcgaatggcaataaatacagcttgtaatgaacttggtcagacatgg
atggaatctggggtcagtgaaaatgcagtttccgggcacatccagctgatgatccctgga
gagtcggcttgcttcgcgtgtgcgccaccacttgtagttgcttcaaatattgatgaaaaa
accctgaaacgagaaggcgtctgcgcagccagtctccccaccaccatgggggtggtggcc
gggatcttggtacaaaatgtactaaagtttctgttaaaatttggcactgtcagtttttac
cttggatacaatgcaatgcaggattttttccctaccatgttcatgaagccaaaccctcag
tgtgatgacaaaaactgtagaaagcaacaagaagaatacaagaagagggcagcagcactg
cccacgcaggaggctgagccccaggaggaggcagaggtggttcatgaggacaacgagtgg
ggcattgagctggtgtctgaggtttcagaagaggaactgaagaactcttcaggtcctgtt
cccaccttacctgaaggcattacagtggcatacacagtcccaaagaagacggaggattcg
gcttctgaagtaacagtggaagactccggcgaaagcttggaagatcttatggccaggatg
aagaatatgtag

DBGET integrated database retrieval system