KEGG   Mus musculus (mouse): 66680
Entry
66680             CDS       T01002                                 

Symbol
Oser1, 3230401D17Rik, AI256769, Perit1
Name
(RefSeq) oxidative stress responsive serine rich 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF776
Other DBs
NCBI-GeneID: 66680
NCBI-ProteinID: NP_079975
MGI: 1913930
Ensembl: ENSMUSG00000035399
Vega: OTTMUSG00000001066
UniProt: Q9D722
Position
2:complement(163247742..163261390)
AA seq 291 aa
MKSEAKDGEEESLQTAFKKLRVDASGSIISLSVGEGPSVRASARTAADDTKPKTMCASKD
SWHGSTRKSSRGAVRTQRRRRSKSPVLHPPKFIHCSTTAPPSSSQLKHRSQTEPPDGISG
RGISTPKEFNAGENSTSLDVNHTGAAIEPLRSSVLRLPSESKTEELSDATQVSQESLTAN
DLSDFQSVSKLSQGKPCVCVGKECQCKRWHDMEVYSFSGLQNVPPLAPERRSLEDYSQSL
HTRTLSGSPRSCSEQARVYVDDVTIEDLAGYMEYYLYIPKKMSHMAEMMYT
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaaatccgaagccaaggatggagaggaggaaagtctgcaaactgccttcaagaaatta
agagtggacgcatcagggtccatcatatctctgtctgttggagaaggcccaagtgtcaga
gcatcagccagaacagcagccgatgataccaaaccgaaaaccatgtgtgcatctaaagac
agttggcatgggtctacaaggaagtcttcacgaggagcagtgagaacccagcgtcgtaga
cggtctaagtctcctgttcttcatcctcccaaattcatacattgcagtacaacagcacct
ccttccagcagccagcttaagcacagaagccagactgagccacccgatggcatcagtgga
cggggaatttcaacacccaaagagttcaacgcaggagaaaactctacttctcttgatgtt
aatcacacaggagcagccatcgagcctctgagaagctcggttctgaggctcccatcagag
agtaaaacagaagagctctctgatgctacccaagtctcccaagaaagtcttacggctaac
gatctctctgactttcaatctgtttccaagctaagtcagggcaagccatgtgtgtgtgta
ggcaaggagtgccagtgtaagaggtggcatgacatggaagtgtattccttttcaggtctg
cagaatgtccctcctctggccccagaacgaagatcacttgaggactactctcagtcactg
cacaccagaactctgtctggctcgcctcgatcctgttccgagcaagctcgtgtctatgtg
gatgatgtgaccattgaggacctagcaggctacatggagtattacttgtatatccctaag
aaaatgtcccacatggcagagatgatgtacacctga

DBGET integrated database retrieval system