KEGG   Mus musculus (mouse): 66690
Entry
66690             CDS       T01002                                 

Gene name
Tmem186, 2810440M13Rik, 4432406C05Rik, AI648175, AW210586
Definition
(RefSeq) transmembrane protein 186
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: TMEM223
Other DBs
NCBI-GeneID: 66690
NCBI-ProteinID: NP_079984
MGI: 1913940
Ensembl: ENSMUSG00000043140
Vega: OTTMUSG00000025205
UniProt: Q9CR76 Q78HW2
Position
16; 16 A1
AA seq 216 aa
MAFLLRVVPRLQGPTAWRRPLQGLWCCSGQGDSKRWVGSRSPHSREKSPGTETETFHTIY
RFRAIRAIGFLSRLKLAQTAVTVVALPPGFYCYSQGLMTLSSLCLLGGVASFALAMLCWM
SHFFRRLVGILYVNESGTLLRVAHLTFWGWRQDTYCAVSDMIPLSESQERVQDVFVRIQQ
YSGKQTFYLTLRYGRILDRERFAQVFGTLATLKNSK
NT seq 651 nt   +upstreamnt  +downstreamnt
atggctttcctccttcgagtcgtgccaaggttgcaggggcccactgcatggaggaggcct
ctacagggactatggtgctgctctgggcagggggattccaaaaggtgggtggggagcagg
tctccccactcacgggagaagtcaccaggcaccgagaccgaaacattccatacaatctac
cggttccgagccatccgagcaattgggttcctctcgcggctgaagttggcccagacagct
gtgactgtggtggccctgcccccgggcttctattgctactcacaaggcctcatgaccctc
agttcactgtgccttctgggtggggtcgccagctttgccctggccatgctctgttggatg
agccacttcttccggagactggtgggcatcctgtatgtgaacgagtcgggcaccctgctc
cgagtggcccacctgaccttctggggctggcggcaggacacgtactgtgccgtgtcagac
atgatacccctgtcagaatcccaggaacgggttcaggatgtgtttgtacgcatccagcag
tacagtggcaagcagaccttctacctcaccttacgctatggccgaatcctggacagggaa
cggttcgcacaagtgttcggaactctggccacactgaagaacagcaagtag

DBGET integrated database retrieval system