KEGG   Mus musculus (house mouse): 66696
Entry
66696             CDS       T01002                                 
Symbol
Snx31, 4631426E05Rik
Name
(RefSeq) sorting nexin 31
  KO
K17937  sorting nexin-31
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    66696 (Snx31)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   66696 (Snx31)
SSDB
Motif
Pfam: SNX17_FERM_C PX FERM_M
Other DBs
NCBI-GeneID: 66696
NCBI-ProteinID: NP_001333951
MGI: 1913946
Ensembl: ENSMUSG00000013611
UniProt: Q6P8Y7
Position
15:complement(36504208..36560274)
AA seq 439 aa
MKMHFCIPVSQQRPDALGGRYVLYSVYLDGFLFCKVRYSQLHRWDEQLRRVFGNCLPPFP
PKYYLAMTTAMAEERRDQLERYLQNVTADPRVTRSDVFTEFLTLVQLHTLNITIQNVELA
VFLPDGRSIKVEGLTSDTAERVLEVMAHKLGLQPDLVGYFGLFLIQCFPEGKLSVVKKLA
DFELPYTSLQSSEMENCKIGLRKWYLDPALDSMLMDCRAAGDLLYMQAVQDIEKEWMKPT
QAQREELKALQKKENQTKFLELSQEVRHYGYVQLDPCTCNHPEPGCGAQLSIGNNEISCC
ITLPNGQIQDIAFQMSRVKCWQVTFLGTLLDTDGPQRTLNQNLELRFQYSEDSCQQWFVI
YTKQAFFLSSCLKKMISERMTKLTEQSPEMQIEVPEQGRSKKHPSQPSQQKVYFNFLRKG
KMKRSEGDYVWDTLMEEGL
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaagatgcacttctgcatcccggtgtcccagcagcggccagacgcgctggggggccgc
tacgtgttgtactccgtgtacctggacgggttcctcttctgcaaagtacgctacagccag
ctgcaccgctgggatgaacagctgagacgggtgtttggaaactgcctgccccctttccca
cccaagtactacctggcaatgactactgctatggctgaagagaggagggaccagttggaa
cgctacctgcaaaatgtaactgcggatccccgtgtgacaaggagtgatgtcttcactgag
tttttaacactggtgcagctgcacacattgaatatcaccatccagaatgtcgagctggct
gtattcctgcctgatggaaggagcattaaagtagaaggtctaacatcagatacggctgaa
agggtcctggaggtgatggcccacaaactcggattgcagccagatctggtgggctacttc
ggccttttccttatccagtgtttcccggagggcaagctctctgtggtgaagaagctggcc
gactttgagctgccttacactagtcttcagagttctgaaatggaaaactgtaagatcggg
ctcagaaagtggtacctggacccagctctggactccatgttgatggactgcagagcagct
ggagacttgctgtacatgcaggcagtgcaggacattgaaaaagaatggatgaaacccaca
caggctcagagggaggaactaaaggcactgcagaagaaagagaatcaaacaaagtttttg
gagctgtcgcaggaggtccggcactatgggtatgttcagctggatccctgcacctgcaac
cacccggaacctggctgtggggcccagctttccatcggcaataatgagatcagctgctgt
ataactttgcctaatggccagatccaggacattgctttccagatgagcagagtgaagtgc
tggcaggtcactttccttggaactctgctggataccgatgggccccagcgaactctcaac
cagaacctagagctgagatttcagtatagtgaagatagttgccagcagtggtttgttatt
tacaccaaacaggcttttttcctgagcagctgcctgaagaagatgatctcagagaggatg
acaaagctcactgagcagagcccagagatgcagatcgaggttccagaacaaggcagaagt
aaaaagcacccgagccaacctagccagcagaaagtctattttaattttctgagaaaaggc
aagatgaagagatccgaaggtgactatgtttgggataccctgatggaagaaggtctctga

DBGET integrated database retrieval system