KEGG   Mus musculus (mouse): 66713Help
Entry
66713             CDS       T01002                                 

Gene name
Actr2, 4921510D23Rik, AA409782, Arp2, D6Ertd746e
Definition
(RefSeq) ARP2 actin-related protein 2
  KO
K17260  actin-related protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    66713 (Actr2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    66713 (Actr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    66713 (Actr2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    66713 (Actr2)
   04147 Exosome [BR:mmu04147]
    66713 (Actr2)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    66713 (Actr2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     66713 (Actr2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   66713 (Actr2)
  Exosomal proteins of other body fluids (saliva and urine)
   66713 (Actr2)
  Exosomal proteins of bladder cancer cells
   66713 (Actr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 66713
NCBI-ProteinID: NP_666355
MGI: 1913963
Ensembl: ENSMUSG00000020152
Vega: OTTMUSG00000005221
UniProt: P61161 Q5SW83
Position
11 A3.1; 11 12.88 cM
AA seq 394 aa AA seqDB search
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE
ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR
EKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTR
RLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL
VESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH
IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAV
LADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggacagccagggcaggaaggtggtggtgtgcgacaacggcactgggtttgtgaagtgt
ggatatgcaggctctaattttccagaacacatcttcccagctttggttggaagacctatt
atcagatcaaccaccaaagtgggaaacattgaaatcaaggaccttatggttggtgatgag
gcaagtgagctgcgttccatgttggaagtgaactaccccatggagaatggcatcgtgcgg
aattgggatgacatgaagcacctgtgggactacacatttggaccagagaaactcaatata
gacaccagaaactgcaagattttacttacagaacctcccatgaatccaaccaaaaacaga
gagaagattgtagaggtaatgtttgaaacttaccagttttctggtgtgtatgtagccatc
caggcagttctgactttgtatgctcaaggtttactgactggtgtagtagtggactctgga
gatggcgtcactcacatttgcccagtatatgaaggcttttctctccctcaccttacaagg
aggctggatattgctgggagggatattaccaggtatcttatcaagctgctgctgttgcga
ggatatgccttcaaccattctgctgattttgagacagttcgcatgattaaggaaaaactt
tgttatgtgggttacaatattgagcaggagcagaagctggccttagagaccacagtgtta
gttgagtcatatacacttccagatggacgtatcattaaggttggaggagaacgatttgaa
gcaccagaggctttatttcagcctcatttgatcaatgtcgagggggttggtgttgctgaa
ctgctttttaacacaatccaggcagccgacattgataccagatctgaattttacaagcac
attgtgctttctggaggttctaccatgtatcctggcctgccatcgaggttggaacgagag
cttaaacagctttacttagaacgagttctgaaaggagatgtggaaaaactttcaaaattt
aagatccgaattgaagacccaccccgcaggaagcacatggtgttcttgggtggcgcagtc
ctagcagacatcatgaaagacaaagacaacttttggatgaccagacaagagtaccaagaa
aagggtgtccgtgtgctggagaaacttggtgtaactgttcgataa

DBGET integrated database retrieval system