KEGG   Mus musculus (mouse): 667214Help
Entry
667214            CDS       T01002                                 

Gene name
9930111J21Rik1, 9930111J21Rik, Iigp
Definition
(RefSeq) RIKEN cDNA 9930111J21 gene 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: IIGP MMR_HSR1 Dynamin_N RsgA_GTPase ABC_tran AAA_16 FeoB_N AAA_29 AIG1 Roc AAA_22 DLIC Sigma54_activat FtsK_SpoIIIE Sigma54_activ_2 Septin T2SSE KAP_NTPase RNA_helicase AAA_30 Zeta_toxin Tox-PLDMTX GP3_package DUF4842 AAA_23
Motif
Other DBs
NCBI-GeneID: 667214
NCBI-ProteinID: NP_001108151
MGI: 3041173
Ensembl: ENSMUSG00000069893
Vega: OTTMUSG00000005529
UniProt: Q5SVP0
Position
11; 11 B1.2
AA seq 844 aa AA seqDB search
MGQTSSSTPPPKEDPDLTSSFGTNLQNFKMKTKILSQELIAFIESSLEDGNLQETVSAIS
SALGGIEKAPLNIAVMGETGAGKSSLINALQGVGDDEEGAAASTGVVHTTTERTPYTYTK
FPSVTLWDLPGIGSTAFQPHDYLKKIEFEEYDFFIIVSSGRFKHNDAELAKAIVQMNRSF
YFVRTHTDLDLMVVKRSNPRRFNRENTLKQIRHTISSMLKEVTHQEPPVFLVSNFDVSDF
DFPKLESTLLSQLPAYKHHMFMLTLPIVTDSTIDRKRDMLKQKVWKESTMPRAWATIPSL
GLTQKDMEMLQQTLNDYRSSFGLDEASLENIAEDLNVTLEELKANIKSPHLLSDEPDTSL
TEKLLKYIGNPYFSKVFHLQNYFIDTVASDVKIILSKEELFTEQHPPLHTATCQPSSSRP
SPLMAQLLVFSFENFFKNFKKESKILSEETITLIESHLEDKNLQGALSEISHALSNIDKA
PLNIAVTGETGTGKSSFINALRGVRDEEEGAAPTGVVETTMKRTPYPHPKLPNVTIWDLP
GIGSTTFPPQNYLTEMKFGEYDFFIIISATRFKEIDAHLAKTIEKMNTKFYFVRTKIDQD
VSNEQRSKPRSFNRDSVLKKIRDDCSGHLQKALSSQPPVFLVSNFDVSDFDFPKLETTLL
RELPSHKRHLFMMSLHSVTETAIARKRDFLRQKIWLEALKAGLWATIPLGGLVRNKMQKL
EETLTLYRSYFGLDEASLENIAKDFNVSVNEIKAHLRSLQLFTKNNDMSFKEKLLKYIEY
ISCVTGGPLASGLYFRKTYYWQSLFIDTVASDAKSLLNKEEFLSEKPGSCLSDLPEYWET
GMEL
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagacttcctcttctacaccccctccaaaagaggatcctgatttgacctccagc
tttggcacaaatcttcagaatttcaagatgaaaaccaaaatcctgtctcaggaattaatt
gccttcattgaatcatccctagaggatggaaaccttcaggaaacagtttctgcaatcagc
agtgctctgggtggcatagagaaagccccactgaacattgcagtgatgggggagactggg
gctggaaagtccagtctcatcaatgctctccagggagtgggggatgatgaagaaggtgca
gctgcttccacaggggtggtacatacaaccactgagagaacaccatacacttacacaaag
tttcccagtgtgacactgtgggacctgcctggcattggatctactgccttccaaccacat
gattatctgaagaaaatcgagtttgaggagtatgacttcttcattattgtctcttccgga
cgctttaaacataatgacgcagaacttgccaaagccattgtgcaaatgaataggagtttc
tattttgttcgaacccacacagatcttgatttaatggttgtaaaacggagtaatcctagg
agattcaacagagagaacacattaaagcagattcgacataccatttcaagtatgcttaag
gaagttacccaccaggagcctccagtcttcttagtctctaactttgatgtgtctgacttt
gacttcccaaagctggaatccacccttctgagccagctcccagcctacaaacaccacatg
ttcatgctcactttgcctattgttacagattccaccatagaccggaagagggatatgctg
aaacaaaaggtctggaaggaatccacaatgccaagagcatgggctaccataccatccctg
ggactgacccaaaaggacatggagatgttgcaacagactttgaatgactatagatcttcc
tttggcctggatgaggcatcactggaaaacatcgctgaggatttgaacgtgacactggag
gagctcaaggcaaacattaagtctccacatttgctctcagatgagccagatacatcctta
acggagaaactattgaagtacattggaaatccttacttttcaaaggttttccatttgcaa
aattatttcattgacacggttgcgagcgatgttaaaattatcctcagtaaagaagagctt
ttcacagagcagcatcctccactgcacacagctacatgccagccttcctctagcagaccc
tctcctttaatggctcaacttttggtgttcagctttgaaaatttttttaagaatttcaag
aaggaaagcaaaatcctctctgaggaaaccatcaccttgattgaatcccatctggaggat
aagaaccttcagggggcattgtctgaaattagtcatgctctgagcaacattgacaaagcc
ccactgaacattgctgtgactggagaaacagggacaggaaaatccagctttatcaatgcc
ttgaggggagtgagggatgaagaagaaggtgcagcacccactggggtggtagagacaacc
atgaagagaactccatacccacacccaaagcttcccaatgtgacaatatgggatttgcct
ggcattgggtctactaccttcccaccacaaaactatctgacagaaatgaagtttggtgag
tatgacttcttcattatcatctcggctacacgcttcaaagaaattgatgcacatctggcc
aaaactattgaaaagatgaacacaaagttctactttgtccgaaccaagatagatcaagat
gtcagtaatgaacagaggagtaaacctaggtctttcaatagagacagtgtgctaaagaaa
ataagagatgactgctcaggtcatctccagaaggctctctccagtcagcctccagtcttc
ctagtctctaactttgatgtgtctgactttgacttcccaaagctggagaccaccctactg
agggaactcccatcccacaagcgccacctcttcatgatgtccttgcacagtgttactgag
actgccattgcccggaagagggatttcctcagacagaagatctggctggaggccctgaag
gctggactatgggccaccattccacttgggggcttagtcagaaataaaatgcagaagttg
gaagagaccttgactctctacaggtcttactttgggctggatgaagcctcactggaaaac
attgccaaggatttcaatgtgtctgtgaatgaaattaaggcacaccttaggtctctccag
ttgttcacaaagaacaatgacatgtccttcaaagaaaaactgttgaaatatattgaatat
atttcctgtgttactgggggaccacttgcctcaggcctttactttagaaagacttactac
tggcaaagtctcttcattgatactgtggcaagtgatgccaagtctctccttaataaggaa
gagtttttgtcagagaagccaggatcatgcctctctgacctccctgaatactgggaaaca
ggaatggagctgtga

DBGET integrated database retrieval system