KEGG   Mus musculus (mouse): 66724
Entry
66724             CDS       T01002                                 

Symbol
Tab3, 4921526G09Rik, Map3k, Map3k7ip3, mKIAA4135
Name
(RefSeq) TGF-beta activated kinase 1/MAP3K7 binding protein 3
  KO
K12793  TAK1-binding protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04936  Alcoholic liver disease
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    66724 (Tab3)
   04668 TNF signaling pathway
    66724 (Tab3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    66724 (Tab3)
   04657 IL-17 signaling pathway
    66724 (Tab3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    66724 (Tab3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    66724 (Tab3)
SSDB
Motif
Pfam: CUE zf-RanBP Tmemb_cc2
Other DBs
NCBI-GeneID: 66724
NCBI-ProteinID: NP_080005
MGI: 1913974
Ensembl: ENSMUSG00000035476
Vega: OTTMUSG00000017925
UniProt: Q571K4 B1ASY9 Q9D5S8
Structure
PDB: 
3A9K

Position
X; X C1
AA seq 716 aa
MAQNSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHS
PEDNRMNRNRLLHINLGIHSPSSYHPGDGAHLNGGRTLVHSSSDGHIDPQHTAGKQLICL
VQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPP
PPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIFIRQTSQSSS
GRQTPQNAPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSVYHSPPPSQC
PSPFSSPQHQVQPPQLGHPSSHVFMPPSPSTTPPHLYQQGPPSYQKPGSHSVAYLPYTAS
SLPKGSMKKIEITVEPSQRPGTAITRSPSPISNQPSPRNQHSLYTATTPPSSSPSRGISS
QPKPPFSVNPVYITYTQPTGPSCAPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEER
SAAPEPIQPISVIPGSGGEKGNHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLE
KEELERLKAEVNSMEHDLMQRRLRRVSCTTAIPTPEEMTRLRSTNRQLQINVDCTLKEVD
LLQSRGNFDPKAINNFYDHIEPGPVVPPKPSKKDSSDSCAIERKARRISVTSKAPVDIHD
AQAAAADEHLSICKQSARTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggcgcaaaacagtccacagcttgatattcaggttctccatgatcttcgacaacgtttt
cctgaaattccagagggtgtggtatcccagtgcatgttacagaataacaacaatctagaa
gcctgttgtcgagccctttcccaggagagcagcaaatacttgtatatggaataccatagt
ccagaagacaatagaatgaatagaaatcgccttttgcatattaatttgggtattcattct
cctagtagctaccacccaggagatggagctcaccttaatggtggtcggacactggtacat
agctcaagtgatggacatattgatcctcagcatacagcaggcaaacagctgatatgttta
gttcaggaaccacactcagctccagctgttgtggctgctactcccaactataatccgttt
tttatgaatgagcagaacagaagtgcagctaccccgccttcacagccacctcagcagcca
tcttccatgcaaacaggaatgaatccatctgctatgcaaggtccttcaccaccaccacca
cctccgtcctacatgcacatacctcggtatagtacaaatccaattactgttacagtgtcc
caaaaccttccttctggacagactgtgccaagagctttacagattcttccacaaattcca
agcaatctctatggatctcctgggtctatttttattagacagacatctcagagttcatca
ggaagacagactcctcagaatgctccatggcagtcctcaccacaaggcccagtgcctcat
tacagccagcgtcctttacctgtttatccacatcaacagaactatcaaccttctcagtat
tctcccaaacaacagcagattcctcagtcagtttaccattcaccacctccttctcagtgt
ccttccccctttagctctccacagcatcaagtacaaccaccccagctgggtcacccaagc
tctcatgtgtttatgccacccagtccttcaactactccaccccacctatatcaacaagga
cctcctagttatcagaaaccaggaagtcattcggtagcctatctcccttacacagcatct
agcttacccaaaggttccatgaagaagatagaaattacagttgaaccttctcaaagacct
gggacagcaataactagaagtccgtcacctatcagtaatcaaccatctccaaggaaccag
cattcactgtacacagccaccacaccaccttcaagttccccttcaagagggatctctagt
caaccaaaacctccatttagtgttaatcctgtgtatattacgtatacacagccaactgga
ccttcatgtgctccatcaccatctcctcgggtgataccaaatccaactacagtttttaaa
attactgtaggccgagcaacaactgaaaaccttttaaatttagtggaccaagaagaacgc
tctgcagcaccagaacctattcagcccatttcagtgataccaggctctgggggagaaaag
ggaaaccacaagtatcaaaggagctctagttctggatcagatgactatgcctatacccaa
gccttgctgttacatcagcgagcaagaatggagaggttagcaaagcaattgaaacttgaa
aaagaggagctagagcggttgaaagctgaagttaacagtatggagcatgacctgatgcag
agacggcttagaagagtcagctgcaccactgcaattcccacgcctgaggaaatgacaaga
ttgagaagcacgaacagacaactccagataaatgttgactgtacactgaaagaagttgac
ctccttcaatctagaggaaactttgatccaaaagccatcaataatttttatgaccacata
gaacctggcccagttgtaccaccgaagccatctaaaaaagactcctcagactcctgtgca
attgagagaaaagcccgaagaattagtgtgacttccaaagcgccagtagatatccatgac
gcccaggcagcagctgcagatgaacatttaagtatctgcaaacagagtgctcggacacaa
ccccgagatgaggattatgaaggggctccgtggaattgtgacagctgtacctttctcaac
caccctgcactgaatcgctgtgagcagtgtgagatgccacggtacacttga

DBGET integrated database retrieval system