KEGG   Mus musculus (house mouse): 66740
Entry
66740             CDS       T01002                                 
Symbol
Jkampl, 4931417E11Rik
Name
(RefSeq) JNK1/MAPK8 associated membrane protein like
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: JAMP
Other DBs
NCBI-GeneID: 66740
NCBI-ProteinID: NP_080013
MGI: 1913990
Ensembl: ENSMUSG00000056197
Position
6:complement(73445563..73446621)
AA seq 305 aa
MACFGLYCGKTLLFKNSSTEIYGECGACPRGQRTNDQKYCQPCTDPPELYDWLYLGFMAM
LPLVSHLLCIQWNAKNSNSRGVFFQQVSALLECSMAAVVTLLVSNPVGTLVIHSCRVLML
SDWYTMLYNPSPDYITTVHCTQEAVYPLYTIVFVYYAFCLVLMLLLRPLLVKKIQWHLYV
SNQLESMYAALYFFPGLTVLQAVAGGLLYYAFPYIVLVASLANLAVYLVFAKVESYSDLI
KKDRLLVLFSQWFLHAYGLMALSRGQQLEQDLLLLTLVPAPTLFYFFTIKFTKPSRIIIE
GTKEH
NT seq 918 nt   +upstreamnt  +downstreamnt
atggcatgctttggactctattgtgggaagactctattgtttaaaaatagctcaactgaa
atctatggagagtgtggggcgtgcccaagaggacagagaacaaatgaccagaagtactgt
cagccttgcacggaccccccggaactttatgactggctttaccttggcttcatggcgatg
cttcctctcgtttcccatttgctctgcattcaatggaatgcaaagaatagtaattccaga
ggtgtgtttttccagcaagtctctgcgctattagaatgcagcatggcagctgtggtcaca
ttacttgtgagcaatcctgtcggcacccttgtcatccactcatgtcgggtgctgatgctt
tcagattggtacacgatgctctacaatccaagtccagattacatcaccaccgtgcactgc
actcaggaagccgtgtaccctctgtacactatcgtgttcgtttattacgctttctgctta
gtattgatgctgctgcttcgaccactactggtaaagaagatccagtggcacctatacgtg
tcaaaccagctggaaagcatgtatgcggccctctacttcttcccgggtttgaccgtgctg
caagcagttgcaggaggcctcctatattatgccttcccatacattgtgttggtggcatct
ttggctaatctggctgtttatctggtttttgccaaagtagagagctacagtgatctgata
aaaaaggacagacttctcgttctcttcagccagtggtttcttcatgcctatggcttaatg
gcactctccagggggcagcaacttgagcaagatctgctccttttaactttggtgcctgcc
cccactcttttttactttttcactattaaatttaccaaaccatcacggataatcatcgaa
ggaaccaaagaacactga

DBGET integrated database retrieval system