KEGG   Mus musculus (mouse): 66753
Entry
66753             CDS       T01002                                 

Gene name
Erlec1, 4933407N01Rik
Definition
(RefSeq) endoplasmic reticulum lectin 1
  KO
K14008  endoplasmic reticulum lectin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    66753 (Erlec1)
SSDB
Motif
Pfam: PRKCSH PRKCSH_1
Other DBs
NCBI-GeneID: 66753
NCBI-ProteinID: NP_080021
MGI: 1914003
Ensembl: ENSMUSG00000020311
Vega: OTTMUSG00000005350
UniProt: Q8VEH8
Position
11; 11 A4
AA seq 483 aa
MEEGDGGLRSLVPGGPLLLVLYGLLEASGGGRALPQLSDDIPFRVNWPGTEFSLPTTGVL
YKEDNYIIMTTAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESY
WTYEVCHGKHIRQYHEEKETGQKVNIHEYYLGNMLAKNLLYEKEREAKENEKSNEIPTKN
IEGQMTPYYPVGMGNGTPCSLKQNRPRSSTVMYICHPESKHEILSVAEVTTCEYEVVILT
PLLCSHPKYKFRASPVNDIFCQSLPGSPFKPLTLRQLEQQEEILRVPFRRNKEEDLPSAK
EERFPAIHKPIAVGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFHGGVGWWKYEFCYGK
HVHQYHEDKDNGKTSVVVGTWNQEEHVEWAKKNTARAYHLQDDGTQTVRMVSHFYGNGDI
CDITDKPRQVTVKLKCKESDSPHAVTVYMLEPHSCQYILGVESPVICKILDTADENGLLS
LPN
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggaggaaggagacggcggcttgcggagcctggtccccggagggccactgttgctggtt
ctgtacggtctcctggaggcgtccggcggcggccgagcgctgccccagctcagcgacgac
atccccttccgagtcaactggcctggtaccgagttctctctgcctacaactggagttttg
tataaagaagataattacatcatcatgacaactgctcataaagaaaaatacaaatgtata
cttccacttgtgacaagtggggatgaggaagaagaaaaggattacaaaggccccaatcca
agagagcttttggaaccactatttaaacaaagcagttgttcctacagaattgaatcttac
tggacttatgaggtctgtcatgggaaacatattcgacagtaccatgaagaaaaagaaact
ggccaaaaagtaaatattcatgaatactaccttgggaatatgttggctaagaatcttctg
tatgaaaaagaacgagaagcaaaagaaaatgaaaagtcaaatgagattcccactaaaaac
attgaaggtcagatgacaccctactatcctgttggaatgggaaatggtacaccttgtagt
ctgaaacaaaatcgacccagatcaagtactgtgatgtacatatgccatcctgaatctaag
catgagatcctttcagtagctgaagttacaacttgtgaatatgaagttgtcattttgaca
ccactcttgtgcagtcatcctaaatacaagttcagagcctctcctgtgaatgacatattc
tgtcaatcactgccgggctctccatttaaacccctcacactaagacagttggagcagcag
gaagagatactgagagtgccattcaggagaaataaagaggaagatttgccatctgctaag
gaagagagatttccagccatccacaaacctattgctgttggctctcagccagtgctcact
gttggaacaacccacatttccaagctgacagatgaccagctcatcaaggagttcctaagt
ggctcttactgctttcatgggggtgttggttggtggaaatatgaattctgctatggcaaa
catgtacatcaatatcacgaggacaaagataatggaaaaacttctgtagttgtggggaca
tggaaccaagaagagcatgttgagtgggctaagaaaaatactgctagagcgtatcatctt
caagacgatggcacccagacagtcaggatggtgtcacatttttatggaaatggggatatt
tgtgatataactgacaaacccagacaagtgactgtaaaactaaagtgtaaagaatcagac
tctcctcatgctgtcactgtgtatatgctagagcctcactcgtgccagtatattcttggg
gttgaatctccagtaatctgtaaaattctagatacagctgatgaaaatggacttctttct
ctccccaattaa

DBGET integrated database retrieval system