KEGG   Mus musculus (mouse): 66766Help
Entry
66766             CDS       T01002                                 

Gene name
Tmem239, 4933425O20Rik
Definition
(RefSeq) transmembrane 239
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM239
Motif
Other DBs
NCBI-GeneID: 66766
NCBI-ProteinID: NP_080029
MGI: 1914016
Ensembl: ENSMUSG00000049692
Vega: OTTMUSG00000015507
UniProt: Q9DA47
Position
2; 2 F1
AA seq 151 aa AA seqDB search
MQQPRVESDIIGAGEGPQRAVPWSAWIIRQDWVRWWVCHIPRSWTQWWNTSGWRQPLQRM
LWGLEGTLYLLLALMLCHALFTTGSYLLSSLWPVVAVMWSHLLPAILLLVLSALPALLFA
ASFLLLFSTLLSLVGLLTSMTQPGYAQDLDQ
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagccacgagtggagtcggatatcatcggggctggcgaggggccccagcgggca
gtgccctggtcagcctggatcatccgtcaggactgggtgcgctggtgggtatgccacata
cctcggagctggacccagtggtggaatacatcaggctggcggcaaccactacagcggatg
ctgtggggtctggaggggacactctacctgctgctggcactgatgctatgtcacgcactc
ttcaccacgggctcctacctgctgagctcgctatggcccgtggtggctgtgatgtggagc
cacctgctgccagcaatcctgctgcttgtgctcagtgccctgcctgctctgctcttcgca
gcctccttcctgctgctcttttccacactgctgagcctcgtgggcctgctcacctccatg
actcaaccaggctacgctcaggacttggaccaatag

DBGET integrated database retrieval system