KEGG   Mus musculus (mouse): 66771
Entry
66771             CDS       T01002                                 

Symbol
Gid4, 4933439F18Rik
Name
(RefSeq) GID complex subunit 4, VID24 homolog
  KO
K23335  glucose-induced degradation protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    66771 (Gid4)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   CTLH complex
    66771 (Gid4)
SSDB
Motif
Pfam: Vac_ImportDeg
Other DBs
NCBI-GeneID: 66771
NCBI-ProteinID: NP_080033
MGI: 1914021
Ensembl: ENSMUSG00000018415
Vega: OTTMUSG00000005814
UniProt: Q9CPY6
Position
11; 11 B2
AA seq 217 aa
MPVRTECPPPAGASTTSAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEV
VLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWG
KFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQ
KSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR
NT seq 654 nt   +upstreamnt  +downstreamnt
atgccggtccgcaccgagtgtcccccgccggcgggtgcctcaaccacatccgcggcctca
ctcatcccgccgccgcccatcaacacccagcagcccggcgtggccaccagcttgctctac
agcggctccaagttccgtggccaccagaagagcaaggggaactcgtacgacgtagaggtg
gtgctgcagcacgtggacactgggaactcttacctttgtgggtacctaaagattaaaggc
cttacagaggaatatccaacccttacaaccttctttgaaggagaaataataagcaaaaaa
caccctttcttaactcggaagtgggacgcagatgaagacgtggatcggaaacactggggc
aagtttctggctttttatcagtatgcaaaatcatttaattcagacgactttgattatgaa
gaactgaaaaatggggattatgtcttcatgaggtggaaggagcagttcctagtcccggac
cacacaatcaaagacatcagcggtgcttcctttgctggtttctattacatctgctttcag
aagtcagcagcctccatagagggctactactaccatcggagctcagaatggtatcagtcc
ctcaacctgacccatgttcctgaacacagtgcacccatctatgagttccggtga

DBGET integrated database retrieval system