KEGG   Mus musculus (mouse): 667742Help
Entry
667742            CDS       T01002                                 

Gene name
Piezo2, 5930434P17, 9030411M15Rik, 9430028L06Rik, Fam38b, Fam38b2
Definition
(RefSeq) piezo-type mechanosensitive ion channel component 2
  KO
K22128  piezo-type mechanosensitive ion channel component 1/2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    667742 (Piezo2)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    667742 (Piezo2)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    667742 (Piezo2)
Ion channels [BR:mmu04040]
 Other channels
  Mechanosensitive channel (Piezo)
   667742 (Piezo2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Piezo_RRas_bdg PIEZO Caldesmon
Motif
Other DBs
NCBI-GeneID: 667742
NCBI-ProteinID: NP_001034574
MGI: 1918781
Ensembl: ENSMUSG00000041482
Vega: OTTMUSG00000028308
UniProt: Q8CD54 E9QNW4
Position
18; 18 E1
AA seq 2824 aa AA seqDB search
MASEVVCGLIFRLLLPICLAVACAFRYNGLSFVYLIYLLLIPLFSEPTKATMQGHTGRLL
QSLCITSLSFLLLHIIFHITLASLEAQHRITPAYNCSTWEKTFRQIGFESLKGADAGNGI
RVFVPDIGMFIASLTIWLVCRTIVKKPDTEEIAQLNSECENEELAGGEKMDSEEALIYEE
DLDGEEGMEGELEESTKLKILRRFASVASKLKEFIGNMITTAGKVVVTILLGSSGMMLPS
LTSAVYFFVFLGLCTWWSWCRTFDPLLFGCLCVLLAIFTAGHLIGLYLYQFQFFQEAVPP
NDYYARLFGIKSVIQTDCASTWKIIVNPDLSWYHHANPILLLVMYYTLATLIRIWLQEPL
VQEEMAKEDEGALDCSSNQNTAERRRSLWYATQYPTDERKLLSMTQDDYKPSDGLLVTVN
GNPVDYHTIHPSLPIENGPAKTDLYTTPQYRWEPSEESSEKKEEEEDKREDSEGEGSQEE
KRSVRMHAMVAVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYA
MISSPFMVVYANLLLVLQYIWSFELPEIKKVPGFLEKKEPGELASKILFTITFWLLLRQH
LTEQKALREKEALLSEVKIGSQELEEKEDEELQDVQVEGEPTEKEEEEEEEIKEERHEVK
KEEEEEVEEDDDQDIMKVLGNLVVALFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFL
FCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLED
LGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDLKSIPSKEDNTIYSHAKVN
GRVYLIINRLAHPEGSLPDLAIMNMTASLDKPEVQKLAESGEERPEECVKKTEKGEAGKD
SDESEEEEDEEEESEEEESSDLRNKWHLVIDRLTVLFLKFLEYFHKLQVFMWWILELHII
KIVSSYIIWVTVKEVSLFNYVFLISWAFALPYAKLRRAASSVCTVWTCVIIVCKMLYQLQ
TIKPENFSVNCSLPNENQTNIPLHELNKSLLYSAPVDPTEWVGLRKSSPLLVYLRNNLLM
LAILAFEVTVYRHQEYYRGRNNLTAPVSKTIFHDITRLHLDDGLINCAKYFVNYFFYKFG
LETCFLMSVNVIGQRMDFYAMIHACWLIGVLYRRRRKAIAEVWPKYCCFLACIITFQYFV
CIGIPPAPCRDYPWRFKGAYFNDNIIKWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIF
EDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCRSYLDMSKVIIFSYLFWFVLT
IIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNIL
SIGACGYIGALVRNSCWLIQAFSLACTVKGYQMPEDDSRCKLPSGEAGIIWDSICFAFLL
LQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDR
IKARQQKYKKGKERMLSLTQESGEGQDIQKVSEEDDEREADKQKAKGKKKQWWRPWVDHA
SMVRSGDYYLFETDSEEEEEEELKKEDEEPPRKSAFQFVYQAWITDPKTALRQRRKEKKK
LAREEQKERRKGSGDGPVEWEDREDEPVKKKSDGPDNIIKRIFNILKFTWVLFLATVDSF
TTWLNSISREHIDISTVLRIERCMLTREIKKGNVPTRESIHMYYQNHIMNLSRESGLDTI
DEHSGAGSRAQAAHRMDSLDSRDSISSCYTEATLLISRQSTLDDLDGQDPVPKTSERARP
RLRKMFSLDMSSSSADSGSVASSEPTQCTMLYSRQGTTETIEEVEAEAEEEVVEGLEPEL
HDAEEKEYAAEYEAGVEEISLTPDEELPQFSTDDCDVEAPPSYSKAVSFEHLSFASQDDS
GAKNHMVVSPDDSRTDKLESSILPPLTHELTASDLLMSKMFHDDELEESEKFYVDQPRFL
LLFYAMYNTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRPSRRFWMMA
IVYTEVAIVVKYFFQFGFFPWNKDLEIYKERPYFPPNIIGVEKKEGYVLYDLIQLLALFF
HRSILKCHGLWDEDDIVDSNTDKEGSDDELSLDQGRRGSSDSLKSINLAASVESVHVTFP
EQPAAIRRKRSCSSSQISPRSSFSSNRSKRGSTSTRNSSQKGSSVLSLKQKSKRELYMEK
LQEHLIKAKAFTIKKTLQIYVPIRQFFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGF
WAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVF
GIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYN
YVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRY
PQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGY
QPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWT
ISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMTLGAKAEIATDKLSFPLAVATRNSIAKM
IAGNDTESSNTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMNITIILFRDNVTKSNS
EWWVLNLTGSRIFNQGSQALELVVFNDKVSPPSLGFLAGYGIMGLYASVVLVIGKFVREF
FSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTR
EKTN
NT seq 8475 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggaagtggtgtgcgggctgatcttcaggctgctgcttcccatctgcctggca
gtagcatgtgcgttccggtacaatgggctctcctttgtctaccttatctacctcttgctc
attcctctgttctcagaaccaaccaaagcaacgatgcaaggacacacagggcggttgcta
cagtccctgtgcatcaccagcctctcatttctgctgcttcacatcattttccacatcaca
ctggccagtctggaagctcaacaccgcatcacacctgcttacaactgctcaacatgggaa
aagaccttccggcagattggctttgaaagcttgaagggagctgatgccggcaatggcatc
agggtatttgtgcctgatatcgggatgttcattgcaagtctgaccatctggctggtctgc
agaaccattgttaagaaaccagacacagaagaaatagcccaattgaattctgagtgtgaa
aatgaagaattggctggaggagaaaagatggattcagaggaggcgctgatttatgaagag
gacttagatggagaagaaggcatggaaggagagctagaagaaagcacaaaactaaaaata
cttcgcaggttcgcctctgtcgcctccaaactgaaggagttcattggcaatatgatcacc
acggcgggcaaggtcgtggtgaccatcctactgggctcctcgggcatgatgctgccatct
ttgacctcggctgtgtacttctttgtatttctgggcctgtgtacctggtggtcctggtgc
cgaactttcgacccattgctgttcggctgcctctgtgtcctgctggcaatcttcactgct
gggcacctgattggactttatctgtaccagttccaattcttccaagaagcggtcccgccc
aatgactactatgcaaggttgtttgggatcaagtccgttatccagacagactgtgccagc
acctggaagatcatagtaaacccagacctgtcctggtatcaccatgccaaccccatcctc
ctgctggtgatgtactatacgctggccacgctgattcgcatctggctacaagagcctctt
gtgcaagaggagatggcgaaggaagatgagggtgccctggattgcagctccaatcagaac
acggcagagaggaggcggagcctgtggtatgcaacccagtacccaacagatgagagaaaa
cttttatccatgacccaagatgactacaaaccatctgatggcctgctggtgaccgtgaat
ggcaaccctgtggactaccacaccatccacccaagcctgcccatagagaatggccctgcc
aagacggacctgtacaccactccccagtaccggtgggagccttcggaggagtcctcagaa
aagaaagaggaagaagaggacaagagagaagactccgaaggggaagggagccaggaggag
aaaaggagtgtgagaatgcacgccatggtcgccgtgttccagttcatcatgaagcagagt
tacatctgtgccctcatcgccatgatggcatggagcatcacctaccacagctggctgact
ttcgtgctgttgatctggtcctgcaccctctggatgattcgcaacaggaggaagtatgcc
atgatcagttctcctttcatggtcgtctatgcgaatctgctgctggtgctgcagtacata
tggagcttcgagctccccgagattaagaaggtccccgggtttctagaaaagaaagagccg
ggagaacttgcttcaaagattctcttcaccatcacgttctggctgctcctgaggcagcat
ctcacagagcagaaggccctgagggaaaaggaagcacttctttctgaagtcaaaattgga
agtcaagaacttgaagaaaaggaagatgaggagctccaagatgtacaagtggaaggggag
cccacagagaaggaagaagaagaggaagaggaaataaaggaagaaaggcatgaggtaaag
aaggaagaggaagaggaagtggaggaagatgatgaccaggacatcatgaaggtgctgggt
aatctggtggtggccctcttcatcaagtattggatctacgtctgcgggggcatgttcttt
tttgtcagctttgaggggaaaatcgtcatgtacaaaatcatctacatggtgctgttcctg
ttctgcgtggccttgtaccaggtgcactacgagtggtggaggaagatcctgaagtacttc
tggatgtcggtggtcatttataccatgttggtgctcatcttcatatacacttaccagttt
gaaaacttcccaggcctgtggcaaaacatgaccggattaaagaaagaaaagctcgaggac
ctcggcctgaagcagttcacggtcgctgaactgttcactcgcatattcatccccacctcc
tttctactcgtctgcatcctacacctccactacttccacgatcggttcctggaacttaca
gacctcaagtccatccccagcaaagaagacaacaccatctacagccatgccaaagtcaat
ggtcgcgtgtacctaataataaataggttggcccaccctgaaggaagtcttccagactta
gccatcatgaatatgacggccagccttgataagcctgaggtgcagaagttggcagagtct
ggggaggagaggccagaagagtgtgtcaagaagacggagaagggtgaggctgggaaagac
agtgatgagtctgaggaggaggaagatgaagaagaggaatccgaggaagaagaaagctca
gacctcaggaacaagtggcacctggtgattgaccggctcactgtgctctttctaaaattc
ctggagtatttccacaagttgcaggtgtttatgtggtggatcttggagctgcacatcatc
aaaatcgtctcatcgtacattatctgggtgactgtgaaagaggtgtctctgttcaactat
gtatttttgatttcttgggcatttgctctgccatatgccaaactccgtcgtgcggcttcc
agtgtctgcactgtctggacatgtgtgatcatcgtctgcaaaatgttgtaccagctgcaa
accattaaacctgagaacttttctgtcaactgctccttgcccaatgaaaatcaaaccaac
attccccttcatgagttgaacaagtctcttctctacagtgcccctgttgatcccactgag
tgggtaggcctgaggaagtcctctcctttgctcgtctacctgaggaacaacctcctgatg
ctggcgattttggcctttgaagtcaccgtttaccgccatcaggagtactatcgaggccga
aacaacctgactgctccagtgtctaaaactatctttcatgacatcacaaggttacatcta
gatgatgggcttatcaattgtgccaaatattttgtaaattacttcttctacaagtttggc
ctagagacctgtttcctaatgtccgtgaatgtaattggacagcgaatggacttctacgcc
atgattcatgcctgttggttgatcggtgtcttgtatcgacgcagaagaaaagccattgcc
gaggtctggcccaagtactgctgcttcctggcttgcatcatcaccttccagtacttcgtc
tgcatcggcatcccccctgccccttgccgagattatccatggagatttaagggagcctac
ttcaatgataacattatcaagtggctgtacttcccggatttcattgtgcggcccaacccc
gtgtttcttgtctatgacttcatgctgctcctgtgtgcttccttacaacgacagatcttt
gaggacgaaaacaaggcagccgtgcgcatcatggccggggacaatgtcgagatctgcatg
aaccttgatgcagcctcgttcagccagcataaccctgtgccagatttcattcactgcaga
tcttacttggacatgtccaaagtgatcatcttcagctacctcttctggttcgtcctcacc
atcatcttcattacgggaacaaccaggatcagcatattttgcatgggctacttggtggcc
tgtttctatttcctgctctttggaggggatctgctgctgaagcccatcaagagcatcctt
cgttactgggactggctgattgcatacaacgtgtttgtgatcaccatgaagaatatactg
tcaataggagcctgtggatacattggcgcactagtaagaaacagctgctggttgatccaa
gcgttcagcctggcctgcaccgtgaaaggctatcagatgcctgaagatgactccagatgc
aagctgcccagtggggaggcagggatcatctgggacagcatctgctttgcgtttctgctg
ctgcagaggagagtcttcatgagctactacttcctgcatgtcgtggctgacattaaagca
tcccagatcctggcatccagaggggccgaacttttccaggctacaattgtgaaagctgta
aaggcaagaattgaagaagagaaaaaatccatggaccagctgaagagacagatggatcgc
atcaaagcccggcaacaaaagtacaaaaagggtaaggagaggatgctgagcttgacccag
gagtcaggggaaggccaggacatccagaaagtctcagaagaagatgatgaaagagaagca
gacaaacagaaagccaagggcaaaaaaaagcagtggtggcggccttgggttgatcatgct
tccatggtcaggagtggagattattatttgtttgaaacggatagtgaagaggaggaagaa
gaggaacttaaaaaggaggatgaagaacccccacggaagtcagcattccagttcgtctac
caagcctggattactgatcctaaaacggcactccgacagaggaggaaagagaagaaaaag
ttggccagagaagagcagaaggagagacgcaaaggatctggggacggtccagtggaatgg
gaagatcgagaggatgagccagtcaaaaagaaatctgatggaccagataatatcatcaag
aggatatttaatatcctgaagttcacatgggttctgttcctggccacagtggatagtttc
accacttggctcaactccatctcaagggaacacatcgacatatccacagtcctgcggatt
gaaagatgcatgctgactcgagagataaaaaagggcaatgttccaacacgggaaagcatc
cacatgtactaccagaaccacattatgaacctttcccgagaatccggcctggacacaatc
gacgagcactcgggggctggctccagggcccaggcagcacataggatggatagcttagat
tcccgggacagtatctccagctgctacactgaagcgaccctgctgatctcaaggcagtcc
acccttgatgatttagatggacaagaccccgttcctaaaacaagcgagcgtgctcggcct
aggctccgtaaaatgttcagcctggacatgtcctcttcgtcagctgacagtggcagtgta
gcatcaagcgagcccacacagtgtaccatgctgtattcgcgccaaggaactacggaaacc
atcgaggaggtggaggctgaagctgaggaggaggtggtagaaggtctggagcctgagctc
catgatgcagaagaaaaggaatacgcagctgaatatgaagcaggggtagaggagatcagc
ctcactccagatgaggaattgcctcagttctctacagatgactgtgatgtggaggcgccg
ccctcttacagcaaggctgtcagctttgagcatctatcgtttgcgtcgcaagatgactct
ggggccaagaaccacatggtggtcagtcctgatgacagccgtacagacaagctggagtca
agcatcttaccacctctgactcatgagctgacagccagcgatctgctgatgagcaagatg
ttccatgatgatgagcttgaggagtctgagaagttctacgtggaccagccccggtttttg
ctgctattctatgccatgtataacaccctggtggcccgctcagaaatggtgtgctatttc
gtgattatcctgaaccacatgacctctgcctccatcatcactctcctgttgcccatcttg
atcttcctctgggccatgctgtctgttcccaggcccagccgacgcttctggatgatggcc
atcgtctacactgaggtggcgatcgtagtgaaatacttcttccagttcggcttctttccc
tggaataaggacttggaaatatacaaggaaaggccctactttccaccgaacatcatcggg
gtggagaagaaggagggctatgttctttatgacctcattcagctgctggctctattcttc
catcgctccattctgaagtgtcatggtctatgggacgaggatgacattgttgacagtaac
acagacaaggaaggatcggatgacgagctgtccctcgatcagggcagaagaggctcctca
gactcactgaagtctatcaacctggctgcctctgtagagtctgtccacgtgaccttcccc
gagcagccagcggccatcaggagaaaacgctcctgcagtagctctcagatctccccacgg
tccagcttctcttcaaataggtccaaaagaggcagcacaagcacccggaacagtagccag
aaaggaagcagtgttttaagccttaaacagaaaagcaaacgagaactttacatggaaaag
cttcaagagcatttaatcaaagcaaaggcgtttaccataaagaagactctacagatctat
gtccccattcggcaattcttctatgacctcatccacccagactacagtgctgtgactgat
gtatacgtgctgatgtttctggctgacactgtagacttcattatcatcgtctttggattc
tgggcctttgggaaacactcggcagctgcagatatcacctcttctctatcagaagaccag
gtccccgggccattcctggtgatggtcctcattcagtttggaaccatggtggtggaccgt
gcactctacctcaggaagactgtgctgggcaaggtcatcttccaggtcatcctcgtgttt
gggattcacttctggatgttcttcatcttacccggtgtgactgagaggaaattcagccag
aacctggtggcacagctttggtactttgtgaagtgtgtgtactttgggctgtctgcctat
caaatccgctgtggctacccaacccgtgtgctcgggaacttcctcacaaagagctacaat
tacgtcaacctcttcttgtttcaagggttccgcctggtcccatttctgactgagctgcgg
gctgtgatggattgggtgtggacagatacaaccctgagcctctccagctggatttgtgtg
gaggacatttacgcgcacatttttatcttaaagtgctggcgagagtcggaaaagagatac
cctcaacccaggggtcagaagaagaagaaagccgtgaagtacggcatgggcggcatgatc
atcgtccttctcatctgtatcgtctggtttcctctgctcttcatgtctttgatcaaatct
gtcgcaggggttatcaaccaacccctggatgtgtccgtcacaattaccctgggaggttat
cagcctatcttcacaatgagcgcccagcaaagccagctgaaagttatggataattcaaag
tataatgaatttctaaaatctttcggccccaacagtggcgcaatgcaatttctggagaac
tatgaaagggaagacgtaacagtagcagaactggaagggaactcgaattctttgtggacc
atcagccctcccagtaagcagaaaatgatacaggagctcaccgaccccaatagttgcttc
tctgttgttttttcatggagtatccagagaaacatgactttgggtgcaaaagccgaaata
gcaacggataagctttctttccctcttgcggtcgcaacacggaatagcatagctaaaatg
attgctggcaatgacacagaaagttcaaacacgccagtgacaatagagaagatctaccca
tactatgtgaaggcacccagcgattcaaactcaaagcctataaaacagcttctgtctgaa
aataatttcatgaatatcaccatcattttgttcagagacaatgtcacaaagtccaatagt
gagtggtgggttctcaacctgaccggaagtaggatattcaaccaggggtcccaagccttg
gaactggtggtcttcaatgacaaagtcagccctccaagtctaggcttcttggctggctat
ggtatcatgggattgtatgcatctgttgtccttgtaattgggaaatttgttcgtgagttc
ttcagtgggatctctcattccatcatgtttgaagagcttccaaatgtggacagaatcttg
aagttgtgcacagatatattcctcgtgagggagacaggggagttggaactggaggaagac
ctctacgccaagttgatattcctgtacaggtcaccagaaaccatgatcaagtggactaga
gaaaaaacaaactga

DBGET integrated database retrieval system