KEGG   Mus musculus (house mouse): 66784
Entry
66784             CDS       T01002                                 
Symbol
Fam187a, 4933439F11Rik
Name
(RefSeq) family with sequence similarity 187, member A
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: V-set Ig_3 I-set Ig_2 Ig_6 ig
Other DBs
NCBI-GeneID: 66784
NCBI-ProteinID: NP_080042
MGI: 1914034
Ensembl: ENSMUSG00000075510
UniProt: Q9D3R5
Position
11:102775995..102777557
AA seq 417 aa
MSLAHTTVLLWAWGSLQAFEIVEKESVFQRTPCPAFLVFDNAAYLADMSFELPCHCKPED
VSAVVWYYQKHLGSKRTTVLTDFDGRLLTEAAHVRVGSSMLVRFSIRMFSLLVFRAQPED
TGLYFCGTREGDYFYAYDVDIQSNKEIVASFKDMAQEPLPDEYYGALHVFTTFWEWTPCD
RCGVRGEQWRFGLCYLQYPDLSPRYIKTRSAVVSCGSGAVPWKLHLQTKYHTPELQFQSC
LVSCQKRNKTRKGVLAIYSYVSKLGSRPWVPQVPIQFHQQRLGHGLIISCPGARPEHAVA
WDKDNQPLYRAQYLKGVNRSMRVFIDHGNHLHIRFTQLSDRGIYYCWLQGLKIAGFRLGV
ITRGRYPASLSDPETRTAIELTLMGYLLITIFFITIHLCRCCCQSRCCPNFSAQTLL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgagtttggcccacaccaccgtgctcctgtgggcctggggcagtctccaggcctttgaa
atcgtggagaaggagagcgtttttcaaaggacaccttgccctgctttcctggtgtttgat
aacgctgcctacctggctgatatgagctttgagcttccctgtcactgcaaacccgaggac
gtttctgcagtggtctggtattaccagaagcacttggggagcaagcgcaccacggtgctc
acagactttgatgggcggttgctcaccgaagccgctcacgttcgcgtaggcagcagcatg
ctggtgcgattcagcatccgcatgttcagcctgttggttttccgggcccagccagaggac
acaggcctatatttttgtggcacccgtgagggggactatttttatgcctatgatgtggac
atccagagcaataaagaaatagtggccagtttcaaggacatggcccaggagccgttgcca
gatgagtactatggggccctccatgtctttaccactttctgggagtggaccccctgtgac
cgctgtggcgtgcgtggagaacagtggcgctttgggctctgctacttgcagtaccctgac
ctctcgcctcgctacattaagactcggtccgccgtagtgtcctgtggctctggggctgtg
ccgtggaaactgcatctccagaccaaatatcacacacccgagctgcagtttcagagctgt
ctagtgtcctgtcagaagaggaacaagacccggaagggtgtgctggcaatctacagttat
gtgtccaaactgggcagccggccctgggtgcctcaggttcccattcagttccatcagcag
agactaggtcacggcctcatcatctcctgtcccggggcccgaccagagcatgctgtggcc
tgggacaaggacaaccagcccctctaccgagcccagtacctaaaaggtgtgaacaggtcc
atgagagttttcatcgaccacggcaaccatctccacatccgcttcacccagctgagtgac
cggggcatctattactgctggctgcaagggttaaaaatcgctggcttccggttgggcgta
ataacccgagggcgctacccagcctcactctcagacccggagactcgcacagccatagag
ctcaccctgatgggctatctgctcatcaccatcttcttcatcaccattcacctctgtcgt
tgctgttgccaatctcgctgttgtcccaacttctctgcccaaacccttctctag

DBGET integrated database retrieval system