KEGG   Mus musculus (mouse): 66787
Entry
66787             CDS       T01002                                 

Symbol
Gskip, 4933433P14Rik
Name
(RefSeq) GSK3B interacting protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: GSKIP_dom DUF6008
Other DBs
NCBI-GeneID: 66787
NCBI-ProteinID: NP_848728
MGI: 1914037
Ensembl: ENSMUSG00000044715
UniProt: Q8BGR8 Q3TBR1
Position
12:105651611..105669317
AA seq 144 aa
MGARRMETDYNPVELSSMSGFEEGSELNGFEGADMKDMQLEAEAVVNDVLFAVNHMFVSK
SMPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQVEDHLQTPYHETVYSLLDTLS
PAYREAFGNALLQRLEALKRDGQS
NT seq 435 nt   +upstreamnt  +downstreamnt
atgggcgctcgcagaatggaaacagactataatcccgtggagctaagcagtatgtctgga
tttgaagaaggctccgagctcaatgggtttgaaggagcggatatgaaggacatgcagctg
gaggccgaggcagttgtaaacgatgtactctttgctgtcaaccacatgtttgtctcaaaa
agcatgccctgtgcagatgatgtggcttacatcaatgtggagacaaaggaaaggaacaga
tactgcctggagctcacagaagcagggctcagggtggtgggctatgcttttgaccaggtg
gaggatcatttgcaaaccccctaccatgagacagtctactccttgttggatactctcagc
cctgcctaccgggaagcattcggaaacgcgctccttcagagactggaagctttgaaacga
gatggacagtcatga

DBGET integrated database retrieval system