KEGG   Mus musculus (house mouse): 66809
Entry
66809             CDS       T01002                                 
Symbol
Krt20, 9030623C06Rik, Ck-20, Ck20, K20, Krt21
Name
(RefSeq) keratin 20
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    66809 (Krt20)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    66809 (Krt20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    66809 (Krt20)
   04147 Exosome [BR:mmu04147]
    66809 (Krt20)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     66809 (Krt20)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   66809 (Krt20)
  Exosomal proteins of other body fluids (saliva and urine)
   66809 (Krt20)
  Exosomal proteins of colorectal cancer cells
   66809 (Krt20)
  Exosomal proteins of melanoma cells
   66809 (Krt20)
SSDB
Motif
Pfam: Filament DivIC DUF1664
Other DBs
NCBI-GeneID: 66809
NCBI-ProteinID: NP_075745
MGI: 1914059
Ensembl: ENSMUSG00000035775
UniProt: Q9D312
Position
11:complement(99319211..99328979)
AA seq 431 aa
MDFSRQSFHRSLSSSSQGPALSMSGSLYRKGTVQRLGAAPSVYGGAGGHGTRISVSKAVM
SYGGDLSNGSDLFGGNGKLAMQNLNDRLANYLEKVRSLEQSNSRLEAQIKQWYETNAPST
IRDYSSYYAQIKELQNQVKDAQVQNAQCVLRIDNAKLAAEDFRLKFETERGMRIAVEADL
QGLSKVYDNLTLQKTDLEIQIEELNKDLALLKKEHQEEVEVLRRQLGNNVNVEVDAAPGL
NLGEIMNEMRQRYEVLAQKNLQEAKEQFERQSQTLQQQVTVNTEELKGFEVQVTELRRTY
QNLEIELQSHLSMKESLERNLEDVKARYASQLAAIQEMLSSLEAQLMQIRSDTERQNQEH
NILLDIKTRLEQEIATYRRLLEGEDIKTTEYQLSTLEMKDIKKTRKIKTVVEEVVDGKVV
SSEVKEIEESV
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggatttcagtcgtcaaagttttcaccgaagtctgagttcctcctcacaaggcccagca
ctcagcatgagtggctcgctgtataggaaggggactgtgcagcgtctgggggctgcaccc
agcgtctatggtggggctggaggccatggcactcgcatctctgtctccaaagccgtaatg
agctacgggggtgatctctccaacggatcggacctgtttgggggcaatgggaaactggca
atgcagaacctgaacgacagattggcaaactacctagaaaaagtgcgctccctggagcaa
tccaattccagacttgaagcccagatcaagcagtggtacgaaaccaacgcgccgagcacc
atccgagactatagctcctactacgcacagattaaagagctgcaaaatcaggttaaggat
gctcaagtacaaaatgcccagtgcgtcctgcgaattgacaatgctaagctggctgcagag
gacttcagattgaagtttgagactgagaggggaatgcgtatagctgtggaagctgatctc
caaggcctgagcaaagtttatgataatctgactcttcaaaagacagacttggaaattcag
attgaagaactgaacaaggacctggccctcctcaaaaaggaacatcaagaggaagttgag
gttcttcgccggcagctgggcaacaatgtcaacgtggaggtggatgctgctccaggcctg
aacctgggagagatcatgaatgagatgagacagagatatgaagtcctggcccagaagaac
ctgcaagaggccaaagaacagttcgagagacagagtcaaactctgcagcaacaagtcaca
gtgaacacggaggagctgaaaggattcgaggttcaagtcacggagctgagacgcacctac
cagaacctggagatagagttgcagtcccacctcagcatgaaagagtctctggagcgcaac
ctagaggacgtcaaggctcgttacgccagccagttggcagccatccaggagatgctgagc
tccctggaggcccaactgatgcagatcaggagtgacacagaacgccagaaccaagaacac
aacatccttctcgacataaagacccggcttgagcaggagatcgccacctaccgccgcctt
ctggagggagaagatataaaaactacagaataccagctgagcactttggaaatgaaggat
atcaagaaaaccaggaagattaagacggtcgtggaagaagtggtagacggcaaggtcgtg
tcctctgaagtcaaggagatagaagagagtgtctaa

DBGET integrated database retrieval system