KEGG   Mus musculus (mouse): 668158Help
Entry
668158            CDS       T01002                                 

Gene name
Ccdc85c, EG668158, Gm265, Gm9010, hhy
Definition
(RefSeq) coiled-coil domain containing 85C
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CCDC85 AMH_N Shugoshin_N FliJ ESSS
Motif
Other DBs
NCBI-GeneID: 668158
NCBI-ProteinID: NP_001153382
MGI: 3644008
Ensembl: ENSMUSG00000084883
UniProt: E9Q6B2
Position
12; 12 F1
AA seq 420 aa AA seqDB search
MAKPPAVAAAAAAAASEELSQVPDEELLRWSKEELARRLRRAEGEKVGLMLEHGGLMRDV
NRRLQQHLLEIRGLKDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQRFGRHAAGAV
WHEVARSQQKLRELEARQEALLRENLELKELVLLLDEERAALAAAGGAGGGGGGAGSRSS
IDSQASLSGPLAGSAAGSGARDVGDGSSTSSAGSGGSPDHHHHVPAALLPPGPHKVPDGK
AGATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRPLETKVKLLDGDKLPPQQAGSGEFRTL
RKGFSPYHSESQLASLPPSYQEVLQNGPACPVPELPSPPSTVYSSAGQKPEAVVHAMKVL
EVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWRKLGDAASTKPSIRQHLSGNQFKGPL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcccccggcggtggcggcggcggctgcagcggcggcgtcggaggagctgagc
caggtcccggacgaggaactgctgcgctggagcaaggaggagctggcgcggcggctgcgg
cgcgccgagggcgagaaggtgggcctcatgctggagcacggcggcctgatgcgcgacgtg
aaccggcggctgcagcagcacctgctggagatccgcggcctcaaggacgtgaaccagcgg
ctgcaggacgacaatcaggagctgcgtgagctctgctgtttcctggacgacgaccggcag
aaagggcgcaagctggcgcgcgagtggcagcgcttcggacgccacgcggccggcgccgtg
tggcacgaggtggcccgctcgcagcagaagctacgggagctcgaggcgcgccaggaggcc
ctgctgcgcgagaacctggagctgaaagagctggtgctgttgctggacgaggagcgcgcg
gcgctggcggcggcggggggcgctggcggcggcggcggcggcgcgggctcccgcagctcc
atcgacagccaggccagcctgagcgggcccctggcggggagcgcagcgggctcgggggcc
cgcgacgttggcgacggcagcagcacgtccagtgcgggcagcggcggcagcccggaccac
caccaccacgtcccagcggctctgctgcccccggggccgcacaaggttccggacggcaag
gccggagccacgcgccggtctctggatgacctgtcagcgccgccgcaccaccgaagcatc
cctaacggcctgcacgatccctcgtccacttacatcaggccattggagaccaaggtgaag
ctgttggacggtgacaagctccccccacagcaggcaggctctggagaattccgtaccctt
cggaaaggcttctccccataccattcggaatcccagctcgcatccctgccgccctcctac
caagaagtcctacagaacggcccagcctgccccgtacccgagctgccctcacccccgtcc
accgtctacagttcggcaggacagaaacccgaggctgtcgtgcacgccatgaaggttctg
gaagtacatgagaaccttgaccggcaacttcaagacagctgtgaggaggacctgagcgag
aaggagaaggccatcgtgcgagagatgtgcaacgtggtctggaggaaactgggggacgcc
gccagcaccaagccctccatccggcagcacctgtctggtaatcagttcaaggggccattg
tag

DBGET integrated database retrieval system