KEGG   Mus musculus (mouse): 66816
Entry
66816             CDS       T01002                                 

Gene name
Thap2, 2900040O07Rik, 9030625G08Rik, AI450385, AI649097
Definition
(RefSeq) THAP domain containing, apoptosis associated protein 2
  KO
K23204  THAP domain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    66816 (Thap2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   Transposable elements
    66816 (Thap2)
SSDB
Motif
Pfam: THAP
Other DBs
NCBI-GeneID: 66816
NCBI-ProteinID: NP_080056
MGI: 1914066
Ensembl: ENSMUSG00000020137
UniProt: Q9D305
Position
10; 10 D2
AA seq 217 aa
MPTNCAAAGCAATYNKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHTFLCSKHFEAS
CFDLTGQTRRLKMDAVPTIFDFCTHIKSLKLKSRNLLKTNNSFPPTGPCNLKLNGSQQVL
LEHSYAFRNPMEAKKRIIKLEKEIASLRKKMKTCLQRERRATRRWIKATCFVKSLEASNM
LPKGISEQILPTALSNLPLEDLKSLEQDQQDKTVPIL
NT seq 654 nt   +upstreamnt  +downstreamnt
atgccgaccaattgcgccgcggcgggctgtgctgctacctacaacaagcacattaacatc
agcttccacaggtttcctttggatcctaaaagaagaaaagaatgggttcgcctggttagg
cgcaaaaattttgtgccaggaaaacacacttttctttgctcaaagcactttgaagcctcc
tgttttgatctaacaggacaaacccgacgacttaaaatggatgctgttccaaccattttt
gatttttgtacccatataaagtctctgaaactcaagtcaaggaatcttctgaagacaaac
aacagttttcctccaactggaccatgtaatttaaagctgaacggcagtcagcaagtactg
cttgaacacagttatgcctttaggaaccctatggaggcgaaaaaaaggataattaaacta
gaaaaggaaatagcaagcttgagaaaaaaaatgaaaacttgcctgcaaagagaacgcaga
gcaactcgaaggtggatcaaagccacgtgctttgtgaagagcttagaagcaagtaacatg
ctacctaagggcatctcagaacagattttaccaactgccttaagcaatcttcctctggaa
gatttaaaaagtcttgaacaagatcaacaagataaaacagtacccattctctaa

DBGET integrated database retrieval system