KEGG   Mus musculus (mouse): 668173
Entry
668173            CDS       T01002                                 

Gene name
Pex10, AV128229, Gm142
Definition
(RefSeq) peroxisomal biogenesis factor 10
  KO
K13346  peroxin-10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    668173 (Pex10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    668173 (Pex10)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    668173 (Pex10)
SSDB
Motif
Pfam: Pex2_Pex12 zf-C3HC4_3 zf-RING_2 Prok-RING_4 zf-C3HC4 zf-C3HC4_2 zf-rbx1 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 zf-RING_4 zf-ANAPC11 Zn-C2H2_12
Other DBs
NCBI-GeneID: 668173
NCBI-ProteinID: NP_001035866
MGI: 2684988
Ensembl: ENSMUSG00000029047
Vega: OTTMUSG00000010596
UniProt: B1AUE5
Position
4; 4 E2
AA seq 324 aa
MARAGAPEVIRAAQKDEYYLGGLRSAAGEALHSLAGAKKWLEWRKEIELLSDIAYFGLTT
IAGYQTLGEEYVGIIQVDPSQQRVPSRLRRAALVALHAVLPYLLDKALLPLEQELQADGD
APRASQGSLLPGGRSRSGARRWVRHHAATLTEQQRKALQRAVFILRQGFACLHRLHVAWF
YIHGTFYHLAKRLAGITYLRTRRLPGEDQKARTSYGLLGLISLLHLVLSMGLRLYSFRQK
QRARKEWRLHRNLSHRRSSLEDRAVCRTPLCTLCLEERRHSTATPCGHLFCWECITEWCN
TKTECPLCREKFPPQKLVYLRHYR
NT seq 975 nt   +upstreamnt  +downstreamnt
atggcgcgggcgggtgcccctgaagtgatccgggcagcgcagaaggacgagtactacctg
ggaggcctgcggagcgcggcgggtgaagcgctgcacagcctagcgggtgcaaagaaatgg
ctggaatggaggaaagagatcgagttgctctcggacatagcctactttggcctcaccaca
attgcaggctaccagacccttggggaggagtacgttgggatcatccaagtggacccatcc
cagcagcgtgtgccctccaggctccgccgtgcagcgctggttgcactgcatgctgtcttg
ccctacctgctagacaaggcactgctgcccctggagcaggagctgcaagccgatggcgat
gctccccgggcttcacagggcagtctgctacctggaggacgcagccgatcaggggcacgg
cgctgggtgcgtcaccacgcagccaccctgactgaacaacagaggaaggccctccagcgg
gcagtcttcatcctgagacagggcttcgcctgcctccatcggctccacgtggcttggttt
tatattcatggtaccttctaccacctggccaagagactagcagggatcacgtatctccgc
actcgtcgcctgcctggagaggaccagaaggctcgcactagctacggactgctggggctg
atctccctcttgcatctggtgctgtccatggggctgcggttgtacagcttcaggcagaag
cagcgagccaggaaggagtggcggctgcaccgcaatctatcccaccgcaggagttccctt
gaagacagagccgtgtgcagaaccccactctgcaccctatgcttagaggaacgaagacac
tccacggccacaccttgtggccatctcttctgctgggagtgcatcaccgagtggtgcaac
accaagacagaatgtcccctgtgccgggagaagtttccacctcagaagctggtctacctg
agacactaccgctga

DBGET integrated database retrieval system