KEGG   Mus musculus (mouse): 66824Help
Entry
66824             CDS       T01002                                 

Gene name
Pycard, 9130417A21Rik, Asc, CARD5, TMS-1, TNS1, masc
Definition
(RefSeq) PYD and CARD domain containing
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04625  C-type lectin receptor signaling pathway
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    66824 (Pycard)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    66824 (Pycard)
   04623 Cytosolic DNA-sensing pathway
    66824 (Pycard)
   04625 C-type lectin receptor signaling pathway
    66824 (Pycard)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    66824 (Pycard)
   05133 Pertussis
    66824 (Pycard)
   05134 Legionellosis
    66824 (Pycard)
  09172 Infectious diseases: Viral
   05164 Influenza A
    66824 (Pycard)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD PYRIN
Motif
Other DBs
NCBI-GeneID: 66824
NCBI-ProteinID: NP_075747
MGI: 1931465
Ensembl: ENSMUSG00000030793
Vega: OTTMUSG00000025367
UniProt: Q9EPB4 Q54AA2
Structure
PDB: 

Position
7; 7 F3
AA seq 193 aa AA seqDB search
MGRARDAILDALENLSGDELKKFKMKLLTVQLREGYGRIPRGALLQMDAIDLTDKLVSYY
LESYGLELTMTVLRDMGLQELAEQLQTTKEESGAVAAAASVPAQSTARTGHFVDQHRQAL
IARVTEVDGVLDALHGSVLTEGQYQAVRAETTSQDKMRKLFSFVPSWNLTCKDSLLQALK
EIHPYLVMDLEQS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggggcgggcacgagatgccatcctggacgctcttgaaaacttgtcaggggatgaactc
aaaaagttcaagatgaagctgctgacagtgcaactgcgagaaggctatgggcgcatccca
cgcggggccctgctgcagatggacgccatagatctcactgacaaacttgtcagctactat
ctggagtcgtatggcttggagctcacaatgactgtgcttagagacatgggcttacaggag
ctggctgagcagctgcaaacgactaaagaagagtctggagctgtggcagctgcagccagt
gtccctgctcagagtacagccagaacaggacactttgtggaccagcacaggcaagcactc
attgccagggtcacagaagtggacggagtgctggatgctttgcatggcagtgtgctgact
gaaggacagtaccaggcagttcgtgcagagaccaccagccaagacaagatgaggaagctc
ttcagctttgttccatcctggaacctgacctgcaaggactccctcctccaggccttgaag
gaaatacatccctacttggtgatggacctggagcagagctga

DBGET integrated database retrieval system