KEGG   Mus musculus (mouse): 66824
Entry
66824             CDS       T01002                                 

Gene name
Pycard, 9130417A21Rik, A, Asc, CARD5, TMS-, TMS-1, TNS1, masc
Definition
(RefSeq) PYD and CARD domain containing
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04625  C-type lectin receptor signaling pathway
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05135  Yersinia infection
mmu05164  Influenza A
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    66824 (Pycard)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    66824 (Pycard)
   04623 Cytosolic DNA-sensing pathway
    66824 (Pycard)
   04625 C-type lectin receptor signaling pathway
    66824 (Pycard)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    66824 (Pycard)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    66824 (Pycard)
   05135 Yersinia infection
    66824 (Pycard)
   05133 Pertussis
    66824 (Pycard)
   05134 Legionellosis
    66824 (Pycard)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    66824 (Pycard)
SSDB
Motif
Pfam: CARD PYRIN CARD_2
Other DBs
NCBI-GeneID: 66824
NCBI-ProteinID: NP_075747
MGI: 1931465
Ensembl: ENSMUSG00000030793
Vega: OTTMUSG00000025367
UniProt: Q9EPB4 Q54AA2
Structure
PDB: 
2N1F

Position
7; 7 F3
AA seq 193 aa
MGRARDAILDALENLSGDELKKFKMKLLTVQLREGYGRIPRGALLQMDAIDLTDKLVSYY
LESYGLELTMTVLRDMGLQELAEQLQTTKEESGAVAAAASVPAQSTARTGHFVDQHRQAL
IARVTEVDGVLDALHGSVLTEGQYQAVRAETTSQDKMRKLFSFVPSWNLTCKDSLLQALK
EIHPYLVMDLEQS
NT seq 582 nt   +upstreamnt  +downstreamnt
atggggcgggcacgagatgccatcctggacgctcttgaaaacttgtcaggggatgaactc
aaaaagttcaagatgaagctgctgacagtgcaactgcgagaaggctatgggcgcatccca
cgcggggccctgctgcagatggacgccatagatctcactgacaaacttgtcagctactat
ctggagtcgtatggcttggagctcacaatgactgtgcttagagacatgggcttacaggag
ctggctgagcagctgcaaacgactaaagaagagtctggagctgtggcagctgcagccagt
gtccctgctcagagtacagccagaacaggacactttgtggaccagcacaggcaagcactc
attgccagggtcacagaagtggacggagtgctggatgctttgcatggcagtgtgctgact
gaaggacagtaccaggcagttcgtgcagagaccaccagccaagacaagatgaggaagctc
ttcagctttgttccatcctggaacctgacctgcaaggactccctcctccaggccttgaag
gaaatacatccctacttggtgatggacctggagcagagctga

DBGET integrated database retrieval system