KEGG   Mus musculus (house mouse): 66826
Entry
66826             CDS       T01002                                 
Symbol
Tafazzin, 5031411C02Rik, 9130012G04Rik, AW107266, AW552613, G4.5, Taz
Name
(RefSeq) tafazzin, phospholipid-lysophospholipid transacylase
  KO
K13511  monolysocardiolipin acyltransferase [EC:2.3.1.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    66826 (Tafazzin)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    66826 (Tafazzin)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-
     66826 (Tafazzin)
Lipid biosynthesis proteins [BR:mmu01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   66826 (Tafazzin)
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 66826
NCBI-ProteinID: NP_852657
MGI: 109626
Ensembl: ENSMUSG00000009995
UniProt: Q91WF0
Position
X:73325498..73340182
AA seq 262 aa
MPLHVKWPFPAVPRLTWTLASSVVMGLVGTYSCFWTKYMNHLTVHNKEVLYELIENRGPA
TPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVP
VCRGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIIL
PLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSTLPVLERLRAENKSAVEMRKALTDFI
QEEFQRLKMQAEQLHNHFQPGR
NT seq 789 nt   +upstreamnt  +downstreamnt
atgcccctccatgtgaagtggccattccccgcggtgccccggctcacctggactctagcc
agcagcgtcgtcatgggcctagttggcacctacagctgcttctggaccaagtacatgaac
cacctcaccgtgcacaacaaggaagtgctgtatgagctcattgagaaccgaggccctgcc
accccccttatcaccgtctccaaccaccagtcttgcatggatgaccctcatctctggggg
atcctaaaactccgccacatctggaacctgaagttgatgcgttggaccccagcagctgca
gacatctgcttcaccaaggagctgcactcccatttcttcagcttgggcaaatgtgtgcct
gtgtgtcgaggagatggtgtctaccagaaagggatggacttcattttggagaagcttaac
catggggactgggtgcacatcttcccagaagggaaagtaaacatgagttctgagttcctg
cgcttcaaatggggaattggacggctgattgctgagtgtcatctgaatcccatcatcctg
ccactgtggcatgttggaatgaatgatgtcctccctaacagcccaccctacttcccccgc
tttggacagaaaatcaccgtgctgattgggaagcccttcagtacactccctgtgcttgag
cggctccgggcagagaacaagtcagctgtggagatgcggaaagccctcacagacttcatt
caagaggaattccagcggctgaagatgcaggcagaacagctccacaatcatttccagcct
ggaagatag

DBGET integrated database retrieval system