KEGG   Mus musculus (mouse): 66830
Entry
66830             CDS       T01002                                 

Gene name
Nacc1, 2010001H03Rik, 4930511N13Rik, Btbd14b, Nac1
Definition
(RefSeq) nucleus accumbens associated 1, BEN and BTB (POZ) domain containing
  KO
K10486  BTB/POZ domain-containing protein 14
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    66830 (Nacc1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     66830 (Nacc1)
SSDB
Motif
Pfam: BTB BEN
Other DBs
NCBI-GeneID: 66830
NCBI-ProteinID: NP_080064
MGI: 1914080
Ensembl: ENSMUSG00000001910
UniProt: Q7TSZ8
Position
8 C2; 8 41.02 cM
AA seq 514 aa
MAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFN
SSRSAVVELPAAVQPQSFQQILTFCYTGRLSMNMGDQFLLIYTAGFLQIQEIMEKGTEFF
LKVSSPSCDSQGLHPEEAPSSEPQSPVAQTLGWPACSTPLPLVSRVKTEQELDSVQCTPM
AKRLWDSSQKEAGGSGGNNGSRKMAKFSTPDLALNRMPQPLSMATATAAVAVVAVGGCVS
GPSMSERTSPGTSSAYTSDSPSSYHNEEDEEEDAGEEGTDEQYRQICNMYTMYSMLNVGQ
TAEKVEALPEQVVLESRSRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTG
TNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDS
RVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWLPKTKPLHLVEGDNYSSFI
SDTCKIEPDMMSMEHSFETASHDGEAGPSAEVLQ
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggcgcagaccttacagatggagattccaaacttcggcaacagcatccttgagtgcctc
aatgagcagcggctacagggactatactgtgacgtgtcagtagtggtgaagggccatgcc
ttcaaagcccaccgtgctgtgctggccgctagtagctcttacttccgggacctcttcaac
agcagccgcagtgctgtggtagaactgccggccgctgtgcagccacagtcattccagcag
atcctcacattttgttacacaggccggctgagcatgaacatgggagaccagtttctgctc
atctacacagccggcttcctgcagatccaggagatcatggagaaaggcactgagttcttc
ctcaaagttagctctccaagttgcgactcccagggcctgcacccggaggaggccccatcc
tcagagcctcagagtcctgtagcgcagacattggggtggccagcctgtagcacgccactg
ccccttgtgtcacgggtcaagacagaacaggagttggactcagtgcaatgcacacccatg
gccaagaggctgtgggacagcagccagaaggaggctggaggcagtggtggcaacaacggc
agccgcaagatggccaagttctccacgccagacctggcccttaaccggatgcctcagcca
ctctcaatggccacagctacagcagcagtggctgtggttgcagtagggggatgtgtgagt
gggcccagcatgtcagagcggaccagtccaggtacctccagtgcttacaccagtgacagc
cccagctcctaccacaatgaagaggacgaagaagaagatgcaggtgaggagggcacagat
gagcagtaccgtcagatctgcaatatgtatacaatgtacagtatgttgaacgttggccag
acagctgagaaggtagaggcccttcctgagcaggtggtccttgagtcccgcagtcgcatt
cgagtgcggcaagacctggcatctctcccagctgaacttatcaaccagattggcaatcgt
tgccacccaaagctctacgatgaaggtgacccctcagagaagctggagctcgtgacaggc
accaatgtatacatcacaagggcacagcttatgaactgccacgtcagtgcaggcacgcgg
cacaaggtcttgctgcggcggcttctggcttccttctttgaccggaatacactggccaat
agctgtggcaccggcatccgttcttccaccaatgaccccagacgaaagccactggacagt
cgtgtcctccatgctgtcaagtactactgccagaacttcgcccccaacttcaaggagagc
gagatgaatgccattgcagctgacatgtgcaccaatgcccgccgagtggtacgtaaaagc
tggctgcccaagactaagccgctgcacctggtggagggtgataactacagcagcttcatc
agcgacacttgcaagatagaaccggacatgatgagcatggaacacagcttcgagacagcc
agccacgatggcgaggctggcccttcagctgaggttctccagtaa

DBGET integrated database retrieval system