KEGG   Mus musculus (mouse): 668303Help
Entry
668303            CDS       T01002                                 

Gene name
Kif26a, mKIAA1236
Definition
(RefSeq) kinesin family member 26A
  KO
K10404  kinesin family member 26
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    668303 (Kif26a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     668303 (Kif26a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd
Motif
Other DBs
NCBI-GeneID: 668303
NCBI-ProteinID: NP_001091090
MGI: 2447072
Ensembl: ENSMUSG00000021294
Vega: OTTMUSG00000033713
UniProt: Q52KG5
Position
12; 12 F1
AA seq 1881 aa AA seqDB search
MVGRGASLCAVQPAVAECGPARETPPLEVSPRKRLPAGLDQDPCSSRPAPEGAGASAEQS
HSAGGGGWCRHCHTKLVELKRQAWKLVSGPGTPLRDPCLSTLLLDKLPASGVQPACRPDT
ESRCDVCTTHLHQLTREALRLLQTPASHEDPNASRGGLAAPSSRDPPGPVGLMGRQPPVG
PDRRKATAWPPGPSVQVSVAPAGLGGALSTVTIQAQQCLEGVWSLSRVNSFLPPTCLAEA
AVAAVAVADTVRDCAPAAGPERMSKAWGRGAACTTALVTPAPGTSAGGSTGPSAAASFFI
RAAQKLSLASKRKKHHPPPAPSTRGTSTYPTDFSGSLQLWPPPVPPCLLRAASKAKENPS
SFGKVKVMLRIWPAQGVQRSAESTSFLKVDSRKKQVTLYDPAAGPPGCAGLRHAPTAPVP
KMFAFDAIFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQ
SLGIVPCAISWLFRLIDERKERLGTRFSIRVSAVEVCGHDQSLRDLLAEVASGSLQDTQS
PGVYLREDPVCGTQLQNQNELRAPTAEKAAFYLDAALAARSTSRAGCGEEARRSSHMLFT
LHVYQYRVEKCGQGGMSGGRSRLHLIDLGSCDAAVGRGGEASGGPLCLSLSALGSVILAL
VNGAKHVPYRDHRLTMLLRESLATTNCRTTMIAHISDSPAHHAETLSTVQLAARIHRLRR
KKGKHASSSSGGESSCEEGRARRPPHLRPFHPRAVVLDPDRSAPGLSGDPDYSSSSEQSC
DTVIYVGPGGMALSDRELTDNEGPPDFVPIIPALSRRRPSEGPRDADHFRCSTFAELQER
LECIDGSEAFPGPQGGSDGAQASPARGGRKPSLPEATPSRKAVAPTVVTSCPRGSPGHDT
HRSASDPSKTGTQSEQRVDGSRPEPPASDKTSGGGGRRPLPSPAPPPPRQPEAQGIPKEP
GGEGTDSVLRTPPVGMSGQAALPPLLSDSAYLSPSARGRHLERGLLTTTVTLQQPVELNG
EDELVFTVVEELPLGGLAGATRPSSLASMSSDCSLQALASGSRPVSIISSINDEFDAYTS
QMSEGPGDPGEFPEGTAWAGGSPASSIGSWLSDVGVCLSESRGPTPQPPFSPNSAAGPGP
PEFPTPGSSLEESKVRSSECGRPDNPGSARSLHPGEAVATTQTQPGREPWARSPHEVASA
QTIHSSLPRKPRTTSTASRARPSRGPYSPGGLFEDPWLLRAEDCDTRQIASTGRAPSPTP
GSPRLPETQMMLACAQRVVDGCEVASRMSRRPEAVARIPPLRRGATTLGVTTPAASCGDA
PAEAVVHSGSLKTTSGSKKSVSPKGAFFPRPSGAGPPAPPVRKSSLEQSTALTPTQALGL
TRAGAPSAFRGEEEARPSGRSDSSVPKATSSLKARAGKMDVPYRPSGHMSLERCEGLAHG
SSKVRDVVGRPPRAVPRLGVPSASPPLGPAPACRNSPAKGVGATKPPAGGAKGRNLGPST
SRALGAPVKPLGPVAGKTAGGAVPGPRAAPRAVPGIGAKAGRGTIMGTKQAFRAAHSRVH
ELAASGSPSRGGLSWGSTDSDSGNDSGVNLAEERQPSSPALPSPYSKVTAPRRPQRYSSG
HGSDNSSVLSGELPPAMGRTALFYHSGGSSGYESMIRDSEATGSASSAPDSMSESGTASL
GARSRSLKSPKKRATGLQRRRLIPAPLPDAAALGRKPSLPGQWVDLPPPLAGSLKEPFEI
KVYEIDDVERLQRHRLPLRENEAKPSQDAEKGPVCISSKLRLAERRQQRLQEVQAKRDHL
CEELAETQGRLMVEPGRWLEQFEVDPELEPESAEYLVALEQATAALEQCVNLCKAHVMMV
TCFDIGVAATTAVPGPQEVDV
NT seq 5646 nt NT seq  +upstreamnt  +downstreamnt
atggtcggccgcggcgcctccttgtgtgcggtgcagcccgcggtggctgagtgcggcccg
gctcgagagaccccgccacttgaggtatccccgcgcaagaggctgcccgccgggctcgat
caagacccatgcagcagccgccctgctccggagggcgccggggccagcgctgagcagagc
cactcggccggtgggggcgggtggtgccgccactgccacacgaagctcgtggagctaaaa
cgacaggcgtggaagttggtcagcgggcccgggactcctctccgggatccttgcctctct
accttgctgcttgacaagctcccggcctctggggttcagccggcatgccgccctgacacc
gagagccgctgtgacgtatgtaccacgcatctgcaccagctcactcgggaagccctgcgc
ctgttacagacacctgccagtcacgaggaccccaatgcttcccgaggaggccttgcggct
cccagctccagggacccacctggacccgtgggcctcatggggaggcagccccctgtggga
cctgacaggaggaaggcaacggcttggccacctggccccagcgtccaggtgtcggtggca
ccagcaggccttgggggagcattgagtacagtcaccatccaggcccagcagtgcttggag
ggtgtgtggagcctctcaagggtcaacagcttcttgccacccacttgcctggctgaggca
gctgtagctgcggtggctgtggccgacactgtccgagactgtgctccagcagcaggccct
gaacgtatgtcgaaggcgtggggccgaggggcagcatgcactacagccctggttacccca
gccccaggcacctcagcagggggttccacaggcccgtctgcagcggcctctttctttata
agggctgcccagaagctcagcctggcctccaagcgcaagaagcatcacccgccgcctgcg
ccctccacccgaggcacatccacttaccccaccgacttcagtggctctctgcagctgtgg
ccgcccccggtgcccccctgcctgctcagggctgcctccaaggccaaggaaaaccccagc
agcttcggaaaggtgaaggttatgctgcgcatatggccggcacaaggagtccagcgctca
gccgagtccacatccttcctgaaggtggattctcgcaagaagcaggtgactctctatgac
cccgctgccgggcctccaggctgtgcaggactccggcacgcccccaccgcaccagtcccc
aagatgtttgcttttgatgccatcttcccccaggactcggagcaggctgaggtctgctca
gggacagtggctgacgtgctccagtctgtggtcagtggagctgatggctgcattttttcc
tttggccacatgagcctcggcaaatcatacaccatgattgggaaggacagctcaccccag
agcctgggcatcgtgccctgtgctatctcctggctcttcaggcttattgacgaacgcaag
gagaggctgggcacgcgcttctccatccgcgtgtctgccgtggaagtgtgcggccacgac
cagagtctgcgggacctgcttgccgaggtggcttcaggcagccttcaggacacccaatct
ccgggcgtgtacctccgggaggaccctgtgtgtgggacacagctccagaaccagaacgag
ctgcgtgcacccacagcagagaaggcggccttctacctggacgcggccctggcagcccgc
agcaccagccgtgccggctgcggggaggaagcccggcgaagctcccatatgctcttcacc
ctgcacgtgtaccagtaccgtgtggagaagtgtggccaaggaggaatgtctggaggtcgt
agccgcctgcacctgatcgacctgggcagctgcgacgcagccgtcggcagaggaggagaa
gcctcagggggacccctctgtctgtctctgtcagctctgggcagtgtcattctggccctg
gtcaacggggccaagcatgtgccctacagggaccacagactcaccatgttactgcgggag
tccctggctaccaccaattgccgcaccactatgatcgcgcacatctcagactctccagct
caccacgcagagacactcagcacggtgcagctggctgcccgcatccaccgcctgcgcagg
aagaagggcaagcatgcatccagttcctcaggaggagagagctcctgtgaggagggccga
gcccgccgtcccccacaccttcggcccttccacccacgggccgtggtgttggaccccgac
cgctcggctcctggcctgtccggagaccccgattactcatccagcagtgagcagtcctgc
gacacggtcatctatgtgggtcccggtgggatggcactgtcagaccgtgagctcacggac
aacgagggcccacctgacttcgtgcccatcatccccgctctgagccgacgcaggccctcc
gaggggccccgggacgctgaccacttccgctgcagtacgttcgccgagctgcaggagcgt
ctggagtgcatagatggcagcgaggcattccctggcccccagggtggctctgacggagcc
caagccagccctgcccggggaggcaggaaaccctcgttacctgaggccacaccctccagg
aaggctgtggcccccacagtggtcaccagttgccctcgaggcagccctgggcacgatact
caccggagcgcctcagacccctctaagactggtacacagagtgagcagagagtagatggt
tcccggcctgagccacctgcttcagacaagacctcaggaggcgggggcaggaggccactg
cccagtccagcccctccaccgcctcgccagccggaagctcaaggcatccccaaagaacct
gggggagagggtactgacagcgtgctgcggacacccccagtgggcatgagtggacaggcg
gccttgcccccgttgctctcagactcggcttatctctccccgtcggctcgtggacgccat
ctggagagaggcctgctgaccaccacggtgaccttgcagcaaccggtggaactcaatggc
gaggatgagttggtgttcacggtggtagaggagctacctctgggcggacttgcaggggcc
acacggccctccagtctggccagcatgagcagcgactgctccctgcaggctttggcttca
gggtccaggccagtcagtatcatcagtagcatcaatgacgagtttgatgcttatacctca
cagatgtctgagggtcccggagaccccggggagttcccagagggaacagcgtgggctggc
ggcagtccagcctcctccattggctcttggctgagcgacgttggtgtctgcttgtctgaa
agccgtggtcccacaccacagcctcccttcagccccaactctgcagcagggccaggtcca
ccagagtttcctaccccaggcagctccctagaggaaagcaaggtcaggtcctcagagtgt
ggaagaccagacaatcccggctcagcccggagtctccaccctggagaagcagttgcaaca
actcagacccaacctggcagagagccttgggccaggtccccgcatgaggtagcctcagcc
cagactatccactccagcctgcctcggaaacccaggactacctccacagccagccgagct
cgtcctagccggggaccatacagccctggtggcctgtttgaggacccttggctgctccgg
gcagaggactgtgacacgcgccagatagcctctacgggcagagccccaagcccaacccca
ggctcccctcgattgcctgagactcagatgatgctggcttgtgcccagagagtggtagat
gggtgtgaggtggcatccagaatgtcgcggagaccagaggctgtggctcggatcccacct
ttgcggaggggggccaccacactaggagtgaccacacctgctgcatcctgtggggacgct
ccagcagaggcagtggtccattcaggaagcctgaagaccacctcgggcagtaagaagagt
gtttctcccaagggggccttctttccaaggcctagtggggcagggcctccagccccacct
gtgcgcaagtcgagcctggagcagagcacggccctcacccccacccaggccctgggactg
accagggcaggggctccttctgccttccgaggggaggaggaagccaggcctagtggtcgg
tctgattcctctgttcccaaggccacatccagcctgaaagcccgagctggcaagatggac
gtgccataccgtccctctggccacatgtccctggaacggtgtgagggcctggcacatggc
agcagtaaggtcagagatgtcgtaggacggccaccaagggctgtgcccaggttgggtgta
ccatccgccagccctccacttggaccagctcctgcctgtaggaacagcccagccaagggt
gttggagcaaccaagcctcctgctggtggagctaagggtcgtaatctggggccaagtaca
tctcgggctctgggtgctccggtgaagccactagggcctgtggcaggcaagacagctggt
ggcgctgtgccaggaccccgagctgctccacgggctgtgccgggtattggggccaaggcc
ggtcggggcaccatcatgggcactaagcaggcatttcgggctgcccatagccgtgtccac
gaattggcagccagtggatctcctagtagaggtggcctctcctggggctcgacggactcg
gacagcggcaacgacagcggtgtgaacctggctgaagagcggcagccctcgagccctgcc
ctgccctccccttacagcaaagtgaccgctccgaggagaccccagcgctacagcagtggc
catggcagtgacaacagcagcgtgctgagcggcgagctgccccccgccatgggccgcact
gctcttttctaccacagtggcggcagcagtggctacgagagcatgattcgggacagcgag
gccactggcagtgcctcctcagctccagactccatgagtgagagtggaacggcctccctg
ggtgcccgctcccgcagcctcaagtccccgaagaagagagccacaggtctacagcggagg
aggctgatcccggccccacttcctgacgctgctgctttaggccgcaagcccagcctcccc
gggcaatgggtggacttgcccccgcccctggccggctctctgaaggagccttttgagatc
aaggtgtacgaaatagatgacgtggagcgtctgcagcggcaccggctgcctctgagggag
aatgaagccaagccctcccaggacgcagagaagggcccagtgtgcatcagctccaagctg
cgtctcgcagagcgcaggcagcagcgactgcaggaagtgcaggccaaacgtgaccacctc
tgcgaggagctggctgagacccagggccggctgatggtggaacctgggcgctggctagag
cagtttgaggtggacccagagctggagccagagtcagctgaatatctggtggccctggag
caagccacagctgccctggagcagtgcgttaacctgtgcaaggcccatgtcatgatggtc
acctgctttgacattggagttgctgccaccactgctgtacctgggccacaagaggtggat
gtttga

DBGET integrated database retrieval system