KEGG   Mus musculus (house mouse): 66839
Entry
66839             CDS       T01002                                 
Symbol
Dele1, 0610009O20Rik, 2700004E22Rik, DELE1(L), Dele, Kiaa0141
Name
(RefSeq) DAP3 binding cell death enhancer 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Sel1 TPR_16 TPR_12
Other DBs
NCBI-GeneID: 66839
NCBI-ProteinID: NP_077141
MGI: 1914089
Ensembl: ENSMUSG00000024442
UniProt: Q9DCV6
Position
18:38383302..38395682
AA seq 510 aa
MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRLSFDRSGSHGSKRSRD
PKCCGWKDAFHWMSAHVSPNTLRDAISWGTLAVLALHLARQIHFHAPLVAGPQPAERSWH
SPLYRFLSSSWWHPHSSLRRHVLPRSDCPAPRNTGLREPRQGQEDHPSAPSQCLPSDSSL
RSGLLNLPEEEPSDFDFLHASRDFASQAKAAEAHPPGGKNEQDKAKALPLEEAVTSIQQL
FQLSVAITFNFLGTENIKTGDYTAAFSYFQKAADRGYSKAQYNVGLCLEHGRGTPRDLSK
AILFYHLAAVQGHSLAQYRYARCLLQSPGSLSDPERERAVSLLKQAADSGLTEAQAFLGV
LFTKEPHLDEQRAVKYLWLAASNGDSQSRFHLGICYEKGLGAQRNLGEAVKCYQQAAAMG
NEPARERLRTLFNVEAAGPSHLATTGLKSFSSPSLCSLNTLLAGASGLPHASSTGNLGLL
CRSGHLGASHGAPSRTIPSLERSLVRLGFG
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtggcgcctgacagggatcctggggcgagctcttccccgcctgctgggacctggcttc
cgtgggataacgcccaaacccaccagttcagatgggtctcagacaacctcccctaccctg
ccgctcactaggctcagctttgacagatcaggttcccacggttcaaagaggagcagggac
ccaaagtgctgtggatggaaagatgcctttcactggatgtctgctcatgtctccccaaac
acactgcgggacgccatctcatggggcactctggcggtgctggccttgcacctggcgagg
cagatccacttccacgcccctctggtagcaggacctcagccagctgaacgctcttggcac
agtcccctgtaccgcttcctctcctcttcctggtggcacccacactcctcacttcggagg
catgttcttcccaggtctgactgcccagctcccaggaacactggcctcagggaaccaagg
cagggccaggaagaccatccctcagctccatcccagtgccttccctcagatagctccctg
agatctggacttctgaatctgcctgaagaagagcccagtgactttgacttcctgcatgct
agccgagacttcgcatcccaggcaaaggcagccgaggcccacccccctggaggaaaaaat
gaacaagacaaggccaaggctcttcctctggaggaggctgtgacttccattcagcaactc
tttcagctcagtgtagccatcactttcaacttcctggggacagagaacataaagacgggg
gactacacggcagccttttcctacttccagaaagccgcagaccgtggctacagcaaagca
cagtacaatgtgggcttgtgtctcgagcatggcagaggcacccccagggacctcagcaag
gctatcctcttttaccatctggctgccgtccagggccacagcctggctcagtaccgctat
gccaggtgtctgttgcaaagtccaggctctttgtcagaccctgagcgagagagggcagtc
tctctgctgaagcaggctgcagactctggcttgacagaggcccaagctttccttggggtg
ctctttactaaggaaccacacctggatgaacagagagcagtaaaatacctctggctggcg
gccagcaatggggattctcagagcagattccacttgggaatttgctatgagaagggcctt
ggtgcacagaggaatctaggagaggccgtgaagtgctaccagcaggcagcagctatgggg
aatgaacccgcccgggagaggcttcggaccctctttaacgtggaagcagcagggcccagc
cacctggccacgacaggactgaagtctttctccagcccctccctctgcagcctgaacacc
ctgttggctggtgcctcaggcctccctcatgcctcaagcactgggaacctcggcctcctc
tgcagaagtggccatctcggagccagccatggtgcccccagcaggactataccatccttg
gaaaggagcctcgtaagactaggtttcggctaa

DBGET integrated database retrieval system