KEGG   Mus musculus (mouse): 66844
Entry
66844             CDS       T01002                                 

Gene name
Ormdl2, 0610012C09Rik
Definition
(RefSeq) ORM1-like 2 (S. cerevisiae)
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: ORMDL
Other DBs
NCBI-GeneID: 66844
NCBI-ProteinID: NP_077142
MGI: 1914094
Ensembl: ENSMUSG00000025353
UniProt: Q9CQZ0
Position
10; 10 D3
AA seq 153 aa
MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLAM
YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYD
AAHFLINTASLLSVLLPKLPQFHGVRLFGINKY
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaatgtgggggtggcacacagcgaagtaaaccccaacactcgagtgatgaacagtcgg
ggcatctggctggcctacatcatcttggtaggactgctgcatgtggttctcctcagcatc
cctttcttcagcattcctgttgtctggaccctgaccaacgtcatccataacttggcaatg
tatatcttcctacatacagtcaaagggacgccctttgagacccctgaccaaggaaaggct
cggcttttgacacattgggagcagatggactatggactacagtttacctcctcgcgaaag
ttcctcagcatctctcctattgtactttacctcctggccagcttctacaccaagtacgat
gctgctcacttcctcatcaacactgcctcgctgctcagcgtgctgctgcctaagctaccc
cagttccatggggttcgtctctttggaatcaacaaatactaa

DBGET integrated database retrieval system