KEGG   Mus musculus (mouse): 66849Help
Entry
66849             CDS       T01002                                 

Gene name
Ppp1r2, 0610025N14Rik, 2310007G06Rik, 4930440J04Rik, 5430408E15Rik, D16Ertd248e, I-2, IPP-2
Definition
(RefSeq) protein phosphatase 1, regulatory inhibitor subunit 2
  KO
K16833  protein phosphatase inhibitor 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    66849 (Ppp1r2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    66849 (Ppp1r2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     66849 (Ppp1r2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     66849 (Ppp1r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPP-2
Motif
Other DBs
NCBI-GeneID: 66849
NCBI-ProteinID: NP_080076
MGI: 1914099
Ensembl: ENSMUSG00000047714
Vega: OTTMUSG00000023915
UniProt: Q9DCL8
Structure
PDB: 

Position
16 B2; 16 21.41 cM
AA seq 206 aa AA seqDB search
MAASTASHRPIKGILKNKTSAASPPVVPSAEQPRPIVEEELSKKSQKWDEMNILATYHPA
DKDYGLMKIDEPNTPYHNMIGDDEDAYSDSEGNEVMTPDILAKKLAAAEGSEPKYRTREQ
ESSGEEDNDLSPEEREKKRQFEMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMAETAD
GDSMNVEESSQGSTTSDHLQHKSQSS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcaacggcctcgcaccggcccatcaaaggaatcctgaagaacaagacctct
gcggcttcccccccggtggtgccctcggccgaacagccccgcccgatcgtggaagaggaa
ctgagtaagaagtctcagaagtgggatgaaatgaatatcctggcaacatatcatcccgct
gacaaagactatggcttgatgaaaatagacgagccaaacaccccatatcacaatatgata
ggtgacgatgaagacgcctatagtgattcagaaggcaatgaagtcatgactccagatatc
ttagctaagaaattagctgctgctgaaggctcagagccaaagtatcggactcgggagcaa
gaaagtagtggagaggaagataatgacctctcccctgaggagcgagaaaagaagcgacag
tttgaaatgaaaaggaagcttcattacaatgaaggactcaatattaagttagccagacag
ttaatttcaaaagacctacatgatgatgatgaagatgaagaaatggcagagactgcagat
ggagacagcatgaatgttgaagagtcaagtcaaggatctactacaagtgaccatctgcaa
cacaaatcacaaagttcataa

DBGET integrated database retrieval system