KEGG   Mus musculus (house mouse): 668620
Entry
668620            CDS       T01002                                 
Symbol
Zfp936, EG435970, EG668620, Gm9272, I1C0022H11Rik
Name
(RefSeq) zinc finger protein 936
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    668620 (Zfp936)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    668620 (Zfp936)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    668620 (Zfp936)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 C1_1 PHD zf-C2HE C1_4 zinc_ribbon_15 zf-H2C2_5 zf-C2H2_11 zf-C2H2_jaz
Other DBs
NCBI-GeneID: 668620
NCBI-ProteinID: NP_001030065
MGI: 3642994
Ensembl: ENSMUSG00000064194
UniProt: Q3ULA8
Position
7:42763590..42841533
AA seq 456 aa
MDALTFDDVHVHFTREEWSLLDPSQKRLYKDVMLENYRNLTAIGYNWKDHNIEEHCQNDR
RYGRHKITPAGEKPYEYTQWDKAFKYHSHLQKLERNQTGDKNSEVFQHSKVLACQSTLQR
NKRTNTGEKPYKPSYLRMHERTHTGEKPYQCNECDKAFLQLRYLRLHERRHSGEKPYECN
QCGKAFLHLNYLRIHERTHTGEKPYQCNQCGKAFTQRSHLQRHKVVHTGVRPYICNQCNK
AYPQQNYLRKHERTHTGEKPYICNQCNKAFSHQSNLRIHEKTHTGEKPYKCNQCDKAFSH
QSNLQIHERTHTGEKPYKCNQCDKAFAHLKYLRAHERTHTQEKPYKCNQCGKAFLYLSCL
RVHERTHTGEKPYKCNQCDKAFAHLKYLRAHERIHTQEKPYKCNQCGKAFLLLSCLRVHE
RTHTGEKPYKCDQCGKAFTQRSHLKTHKVIHTGGRL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggatgcattgacctttgatgatgtgcatgtacacttcactcgggaggagtggtccttg
ctggatccatctcagaagagactttacaaagatgtcatgctggagaactacaggaatctc
accgctataggctacaattggaaagaccataacattgaagaacattgtcaaaatgataga
agatatggaaggcacaaaatcactcctgctggagagaaaccctatgaatatacacaatgg
gataaagccttcaaatatcacagtcatcttcaaaagcttgaaagaaaccaaactggagac
aaaaactctgaagtctttcaacatagtaaagtgcttgcatgtcaaagtactctacaaaga
aataaaagaacaaatactggagagaaaccctacaaacccagctatcttcgaatgcatgaa
agaacacatactggagagaaaccttaccaatgtaatgaatgtgataaagcctttttacag
ctcaggtatcttagattacatgaaagaagacatagtggagagaaaccctatgaatgtaat
caatgtggtaaagcctttttacatctcaactatcttagaattcatgaaagaacacatact
ggagagaaaccttaccaatgtaatcaatgtggtaaagcctttacacaaaggagtcatctt
caaagacataaagtagtacatactggagtgagaccctacatatgtaatcagtgtaataaa
gcctacccacagcagaattatctccgaaaacatgaaagaacacatactggagagaaacct
tatatatgtaaccagtgtaataaagccttttcacaccagagtaatctccgaatacatgaa
aagacacatacaggtgagaaaccctataaatgtaatcagtgtgataaagccttttcacac
cagagtaatctccaaatacatgaaagaacacatacaggtgagaaaccctataaatgtaat
cagtgtgataaagcctttgcacacctcaagtatcttcgagcacatgaaagaacacatact
caagagaaaccatacaaatgtaatcaatgtggtaaagcttttttatatctcagctgtctt
cgggtacatgaaagaacacatactggagagaaaccttataaatgtaatcagtgtgataaa
gcctttgcacacctcaagtatcttcgagcacatgaaagaatacatactcaagagaaaccc
tacaaatgtaatcaatgtggtaaagcctttttacttctcagctgtcttcgggtacatgaa
agaacacatactggagagaaaccttacaaatgtgatcaatgtggtaaggcttttacacaa
cgcagtcatcttaaaacccataaagtaatacatactggagggagactctaa

DBGET integrated database retrieval system