KEGG   Mus musculus (mouse): 66870Help
Entry
66870             CDS       T01002                                 

Gene name
Serbp1, 1200009K13Rik, 9330147J08Rik, AL022786, Pairbp1
Definition
(RefSeq) serpine1 mRNA binding protein 1
  KO
K13199  plasminogen activator inhibitor 1 RNA-binding protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    66870 (Serbp1)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    66870 (Serbp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IHABP4_N HABP4_PAI-RBP1
Motif
Other DBs
NCBI-GeneID: 66870
NCBI-ProteinID: NP_080090
MGI: 1914120
Ensembl: ENSMUSG00000036371
Vega: OTTMUSG00000057415
UniProt: Q9CY58
Position
6; 6 C1
AA seq 407 aa AA seqDB search
MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQ
TNSNAAGKQLRKESQKDRKNPLPPSVGVADKKEETQPPVALKKEGIRRVGRRPDQQLQGD
GKLIDRRAERRPPRERRFEKPLEEKGEGGEFSVDRPIIERPIRGRGGLGRGRGGRGRGMG
RGDGFDSRGKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQK
QISYNCSDLDQSNVTEETPEGEEHPVADTENKENEVEEVKEEGPKEMTLDEWKAIQNKDR
AKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLEINFGD
LGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggcacctacaggaaggcttcggctgcgtggtcaccaaccgattcgaccagcta
tttgacgacgaatcggaccctttcgaggtactgaaggcagcagagaacaagaaaaaagaa
gccggcgggggcggcgttgggggccccggggccaagagcgcggctcaggccgcggcccag
accaactccaacgcggcgggcaaacagttgcgtaaagagtcccagaaagaccgcaagaac
ccgctgccccccagcgtcggcgtggccgacaaaaaggaggagacgcagccgccggtggcg
cttaagaaagaaggaataaggcgagttggaagaagacccgatcaacaactacagggtgat
gggaaactaattgataggagagcagaaaggcgaccaccccgtgaaagaagatttgaaaag
ccacttgaagaaaaaggtgaaggaggtgaattttcagttgatagaccgattatcgaacgg
cctatccgaggccgaggtggtcttggaaggggtcgaggaggccgtggacgtggaatgggc
cgaggcgatggatttgattctcgtggcaagcgtgaatttgataggcatagtggaagtgat
agatcttctttttcacattacagtggcctgaagcatgaggacaaacgcggaggtagcggc
tctcacaactggggaactgtcaaagatgaattaacagagtcacccaaatacattcagaaa
caaatatcttataattgcagtgatttggatcaatcaaatgtgactgaggaaacacctgaa
ggtgaagagcaccctgtggcagatactgaaaataaggagaacgaagttgaagaggttaag
gaagagggtccaaaagagatgactctggatgagtggaaagctattcaaaataaagaccga
gcaaaagtagaatttaatatccgaaaaccaaatgaaggcgccgatggacaatggaaaaag
ggatttgttctgcataaatcaaaaagtgaagaggctcatgctgaagattcagttatggac
catcatttccggaagccagcaaatgatataacatctcaactggagatcaattttggagac
ttaggccgcccaggacgtggtggcagaggaggacgtggtgggcgtgggcgtggtggacgt
ccaaaccgtggcagcaggactgataagtcaagtgcttctgctcctgatgtagatgaccca
gaggccttcccagctctggcctaa

DBGET integrated database retrieval system