KEGG   Mus musculus (house mouse): 66874
Entry
66874             CDS       T01002                                 
Symbol
Ncbp3, 1200014J11Rik, C130061O14Rik, C78393
Name
(RefSeq) nuclear cap binding subunit 3
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: NCBP3 RNA_bind
Other DBs
NCBI-GeneID: 66874
NCBI-ProteinID: NP_080094
MGI: 1914124
Ensembl: ENSMUSG00000020783
UniProt: Q8BZR9
Position
11:72937443..72974405
AA seq 615 aa
MAAVRGLRVSVKAEAPAGPALGLPSPEVESGLERGEPEPMEVEEGELEIVPVRRSLKELL
PDTSRRYENKAGSFITGIDVTSKEAIEKKEQRAKRFHFRAEVNLAQRNVALDRDMMKKAI
PKVRLETIYICGVDEMSTQDIFSYFKEYPPAHIEWLDDTSCNVVWLDEMTATRALINMSS
LPAQDKMRSRDASEDKSSEKNKKDKQEDSSDDDETEEGEVEDENSSDVELDTLSQVEEES
LLRNDLRPANKLAKGNRLFMRFATKDDKKELGAARRSQYYMKYGNPNYGGMKGILSNSWK
RRYHSRRIQRDVIKKRALIGDDVGLTSYKHRHSGLVNVPEEPIEEEEEEEEEEEDQDMDA
DDRVVVEYHEELPGLKQPRERSLSRRSSASSSDSDEMDYDLELKMISTPSPKKSMKMTMY
ADEVESQLKSIRNPMRADSISTSNIKNRIGNKLPPEKFADVRHLLDEKRQHSCPRPAVSS
TKPDIRQRLGKRPYSPEKAFSSNQVVRREPSSDVHSRLGVPRQDVKGLYSDTRERKSGGL
WTRLGSTPKTKEKNTKKVDHRASGAEEDDSELQRAWGALIKEKEESRQKKSRLDSLPSLQ
IEVSRESSSGSEAES
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggcggccgtccgcggcctgcgagtgtctgtgaaggcggaggcccccgctgggccggct
ttggggcttccgtcgcccgaggtggagtccggtttggagcgtggcgagccggagcccatg
gaagtggaagaaggcgagctggaaatcgtgccggtgcggcgctccctaaaggaactgctc
ccggacacaagcagaagatatgaaaacaaggctggcagcttcatcactgggatcgatgtc
acctccaaggaagcaattgaaaagaaagaacagcgagccaagcgcttccactttcgagca
gaagtaaatcttgcccagagaaatgtagccttggaccgagacatgatgaagaaagcaatt
cccaaggtgagactggagacaatctacatttgtggagtggatgaaatgagcacccaggat
atcttctcctattttaaggaatatcctccagctcacattgagtggttggatgacacctcc
tgcaatgtggtttggctggacgagatgacggccacacgagctctcatcaatatgagttct
ctgccagcccaggataagatgagaagcagagatgccagtgaagacaagtcgtcggagaag
aacaagaaagacaagcaggaagacagttcagatgacgacgagactgaagaaggagaagtg
gaagatgagaattcaagtgatgtagagttggacacgttgtctcaggtagaagaagagtct
ctgttacgaaatgatcttcgtccagctaacaaacttgctaaaggaaatagactattcatg
agatttgctacaaaagatgacaaaaaggaacttggagcagccagaagaagtcaatactac
atgaagtatggaaatccaaattatggaggcatgaaaggaattcttagcaattcatggaag
cgaagatatcattcccgtcgcattcagcgggatgtgatcaagaagagagccctgattggg
gatgacgttggcttgacgtcgtataaacaccgacattccggattagtgaatgttcctgag
gaacccattgaggaagaggaggaggaggaggaggaagaggaggaccaggacatggatgcc
gatgacagagtcgtggtggagtaccatgaggagctcccaggtctcaagcagccccgtgag
cggagcctgtctaggcgatccagtgcgagcagctcagactcagatgagatggactatgat
ctggaactgaagatgatttctactccctccccaaagaaaagcatgaaaatgaccatgtat
gcagatgaagtagagtcccaactgaaaagtattaggaatcccatgagggcagatagtata
tccacaagcaatataaaaaaccgaattggtaacaaattgcctcctgagaaatttgcagat
gtccgtcatctcttagatgaaaagaggcagcattcctgtccacggccagcagtcagcagt
actaaaccagatattcgccagcggttaggaaaaagaccgtattctccagagaaggctttt
agtagtaaccaggtggttcggagagagccctcttcagatgtacatagtaggctaggtgtt
cccaggcaagatgttaaaggcctctactctgatactcgggagaggaaatcaggtggtttg
tggactcgcttaggatctacacccaagaccaaagaaaagaacacgaagaaagtggatcac
agggcatctggtgctgaggaagatgactcggagcttcagagagcatggggtgctctgatc
aaggagaaagaagagtctcgccagaagaagagtcggctggatagcttgccttcgctccag
attgaagtcagccgggaaagtagctctggttcagaggcagagtcctga

DBGET integrated database retrieval system