KEGG   Mus musculus (mouse): 66878
Entry
66878             CDS       T01002                                 

Symbol
Riok3, 1200013N13Rik, D18Ertd331, D18Ertd331e, E130306C24Rik, Sud, Sudd
Name
(RefSeq) RIO kinase 3
  KO
K08872  RIO kinase 3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    66878 (Riok3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     66878 (Riok3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  RIO family [OT]
   66878 (Riok3)
SSDB
Motif
Pfam: RIO1 Pkinase Kdo
Other DBs
NCBI-GeneID: 66878
NCBI-ProteinID: NP_077144
MGI: 1914128
Ensembl: ENSMUSG00000024404
UniProt: Q9DBU3
Position
18 A1; 18 6.15 cM
AA seq 519 aa
MDLVGVSSPEPGPAAAWGPSKCPWATPQNTVSCSLTEVMSEELAKELQLEEEAAAFPEVV
VAEGPFISGENIDTSSDLMLAQMLQMEFDREYDAQLRREEKKFNGDSKVSISFENYRKVH
PFEDSDSSEDEVDWQDTRDDPYRPAKPIPTPKKGFIGKGKDITTKHDEVVCGRKNTARME
NFAPGFQVGDGIGMDLKLSNHVFNALKQHAYSEERRSARLHEKKEHSTAEKAVDPKTRLL
MYKMVNSGMLETITGCISTGKESVVFHAYGGSLEDEKEDGKAIPTECAIKVFKTTLNEFK
NRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLTRMQKAGIPCPTVVLLKKHILVMS
FIGHDQVPAPKLKEVKLSNEEMKDAYYQTLHLMQQLYNECTLVHADLSEYNMLWHAGKVW
LIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVTEALNERELFNAVSGLNISADNEAD
FLAEIEALEKMNEDHIQKNGRKAASFLKDDGSPPVLSAD
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggatctggtcggagtgtcttcgcctgagccagggcccgcagcagcttggggacccagt
aagtgcccatgggctacccctcaaaacacagtatcctgttcactgaccgaggtgatgagt
gaggagctggctaaagagctgcagttggaagaagaagcggctgctttccctgaagttgtt
gttgctgaaggaccattcatttctggagaaaacattgacacttccagtgacctaatgctg
gctcagatgctacagatggaatttgacagagaatatgatgcacagcttaggcgtgaggaa
aagaagttcaatggtgatagcaaagtttccatttcgtttgaaaactatcgcaaagttcat
ccttttgaagacagtgacagctctgaagacgaggttgactggcaggacactcgagacgat
ccctacagaccagcaaagccaattcctactcccaaaaagggttttattggaaaaggaaaa
gacatcaccaccaagcatgatgaagtagtatgtggaaggaagaacacagcaagaatggaa
aattttgcccctggctttcaggtaggggatggaattggaatggatttgaaactatccaac
cacgtttttaatgccttaaaacaacacgcctactcagaagagcgtcggagtgcccgtcta
cacgagaagaaggaacattctaccgctgaaaaagcagttgatcctaagacacgcttactt
atgtataaaatggtcaactctggaatgttggagacaatcactggctgtattagtacagga
aaggaatctgttgtctttcatgcatatggagggagcctggaggatgaaaaggaagatggt
aaagctataccaacagaatgtgccatcaaggtatttaaaacaacccttaatgagtttaag
aatcgtgacaagtacattaaagatgatttcaggtttaaagatcgcttcagtaaactaaat
ccacgtaagatcatccgcatgtgggcagagaaagaaatgcacaatcttacaagaatgcag
aaggctggaattccttgtccaacagttgtactgcttaagaagcacattttagttatgtct
ttcattggccatgatcaagttccagcccctaaattaaaagaagtaaagcttagtaatgaa
gaaatgaaagatgcctactatcagactcttcatttgatgcagcaattatataacgaatgt
acccttgtgcatgctgacctcagcgagtataacatgttgtggcatgctgggaaggtctgg
ttgattgacgtcagtcagtcggtagagccaacccatcctcatggcctggagttcttattc
cgtgactgtaggaatgtttcacagttcttccagaaaggaggagtaacggaagccctcaat
gaacgggagctgttcaatgctgtttctggcctgaacatctcggcagacaatgaagctgat
ttcttagctgagatagaagctttggagaagatgaatgaagatcacattcagaagaacggg
aggaaagcagcctcgtttctgaaagatgatggaagcccacctgtgctgtctgccgactag

DBGET integrated database retrieval system