KEGG   Mus musculus (mouse): 66884Help
Entry
66884             CDS       T01002                                 

Gene name
Appbp2, 1300003O07Rik, AI465480, PAT1
Definition
(RefSeq) amyloid beta precursor protein (cytoplasmic tail) binding protein 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_10 TPR_12 TPR_7 TPR_1 TPR_8 TPR_MalT
Motif
Other DBs
NCBI-GeneID: 66884
NCBI-ProteinID: NP_080101
MGI: 1914134
Ensembl: ENSMUSG00000018481
Vega: OTTMUSG00000001027
UniProt: Q9DAX9
Position
11; 11 C
AA seq 585 aa AA seqDB search
MAAVELEWIPETLYNTAISAVVDNYIRSRRDIRSLPENIQFDVYYKLYQQGRLCQLGSEF
CELEVFAKVLRALDKRHLLHHCFQALMDHGVKVASVLAYSFSRRCSYIAESDAAVKEKAI
QVGFVLGGFLSDAGWYSDAEKVFLSCLQLCTLHDEMLHWFRAVECCVRLLHVRNGNCKYH
LGEETFKLAQTYMDKLSKHGQQANRAALYGELCALLFAKSHYDEAYKWCVEAMKEITAGL
PVKVVVDVLRQASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN
VDNICQSVAIYQAALDIRQSVFGGKNIHVATAHEDLAYSSYVHQYSSGKFDNALFHAERA
IGIITHILPEDHLLLASSKRVKALILEEIAIDCHNKETEQRLLQEAHDLHLSSLQLAKKA
FGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEVALSVGHLASL
YNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVL
SNWNRLRDRQYSVTDALEDVSSSPQSTEEVVQSFLMAQNVEGPSC
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtggagctcgagtggatcccggagacgctctacaacaccgccatctccgct
gtcgtggacaactacatccgctcgcgccgcgacatccgctccttgccggagaatatccag
ttcgacgtttactacaagctttaccaacagggacgcttgtgtcagctcggcagtgaattc
tgtgaattggaagtttttgctaaagttttgagagctttggataaaagacatttgctccac
cactgttttcaggctctgatggaccatggcgttaaggtagcttccgtcttggcctactcc
ttcagtagacggtgctcttacatagcagagtccgacgctgcagtaaaggagaaggccatc
caggttggctttgtcttaggtggctttctttctgatgcaggctggtacagtgatgctgaa
aaggtttttctgtcctgccttcagttgtgtacgctacatgatgagatgctccactggttc
cgagcagtggagtgttgtgtgaggttgcttcatgtgcgaaatggaaattgtaaatatcat
ctaggtgaagaaacatttaaattagctcagacatacatggataagctgtctaaacatggc
cagcaagcaaatagagctgctctctacggagaactatgtgcactcctgtttgcaaaaagc
cactatgatgaggcatacaagtggtgcgttgaggcaatgaaggaaattacagcaggctta
ccagtcaaagttgtggtggatgttttaagacaagcttctaaggcttgtgtagtcaaacgt
gaatttaagaaggcagaacagttaattaaacatgcagtgtatttggcacgagatcatttc
ggatccaaacacccaaaatactctgacacactgctagattatgggttctacttactcaat
gtagacaatatctgtcagtctgttgcaatttaccaggcagccctcgacattcgacagtca
gtgtttggtggcaaaaatattcatgtagcaacagctcatgaagacctggcctactcttcc
tacgttcaccagtacagctctggaaaattcgacaatgcactatttcatgcagaaagagcc
attggtatcattactcacatcctacctgaagatcatcttcttctggcttcttcaaagagg
gtgaaagcacttattctagaggagattgcgattgactgtcacaacaaggagacggagcag
cggctgcttcaggaggcacacgacttgcacttgtcttcgctgcagctggctaagaaagca
tttggggaatttaatgtacagactgcaaagcactatgggaacctcggaaggctctatcag
tcaatgagaaaatttaaggaagctgaagaaatgcacataaaagcaattcagattaaggag
cagctccttggccaagaagattatgaagtggccctttcagtgggacacctggcatctctg
tataattatgacatgaatcagtatgaaaatgctgagaaactgtacctgcggtcgatagcc
attgggaagaaactgtttggtgaaggctacagtggactagaatatgattaccggggcctc
attaaactttacaactccattgggaattatgagaaagtgttcgagtatcacaacgttctg
tctaactggaaccggttgcgagatcgacagtattcagtgaccgatgcccttgaagacgtc
agcagcagcccccagtccactgaagaagtggtgcagtcctttctgatggctcagaatgtt
gagggaccaagctgctga

DBGET integrated database retrieval system