KEGG   Mus musculus (mouse): 66885Help
Entry
66885             CDS       T01002                                 

Gene name
Acadsb, 1300003O09Rik, 2-MEBCAD, BB066609, SBCAD
Definition
(RefSeq) acyl-Coenzyme A dehydrogenase, short/branched chain
  KO
K09478  short/branched chain acyl-CoA dehydrogenase [EC:1.3.99.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    66885 (Acadsb)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    66885 (Acadsb)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.12  2-methylacyl-CoA dehydrogenase
     66885 (Acadsb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 66885
NCBI-ProteinID: NP_080102
MGI: 1914135
Ensembl: ENSMUSG00000030861
Vega: OTTMUSG00000026268
UniProt: Q9DBL1
Position
7; 7 F3
AA seq 432 aa AA seqDB search
MAVSALQLWRMGGLLRRRFPTCLSPWKIPPRVLKSSQPEALVSLTNNAVAFAPLQTLTDE
EIMMKQTVKKFAQEHVAPLVSSMDENSKMEKSVIQGLFQQGLMGIEVEAQYGGTEASFFC
SVLVIEELAKVDASVALLCDIQNTIINNLFRKHASEEQKATYLPKLVTEKLGSFCLSEAG
AGSDSFAMKTRADKSGNYYVLNGSKMWISHAEHAELFLVFANVDPSSGYRGITCFLVDRD
TEGFQIGKRENKMGIRASSTCQLTFENVKVPETNILGKIGHGYKYAIGSLNEGRIGIAAQ
MLGLAQGCFDYTIPYIKERMQFGKRIFDFQGLQHQVAQVATQLEATRLLTYNAARLVEAG
RPFIKEASMAKYYASEVAGLTTSKCIEWMGGVGYTKDYPVEKFFRDAKIGTIYEGASNIQ
LNTIAKHIDAEY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcggtctctgcgctccagctgtggcgtatgggcgggctgctgagaagacgcttccca
acctgcttgtctccttggaagattcctcctcgtgtcctcaaatcctcacaaccggaagct
ctagtcagtctgacaaacaatgcagtagcctttgcacctctgcagacacttactgatgag
gaaattatgatgaagcagacagtcaaaaaatttgcacaggagcacgttgctcctctggtt
tcctctatggatgagaactcaaaaatggagaaatcggtgatccagggattgttccagcaa
gggctgatgggcattgaagttgaagcacaatatggagggacagaagcttcctttttctgc
tctgtcctagtgatagaggaactagctaaggtggatgcttcggtggctctcctgtgtgac
atccagaacacaataattaacaacctgtttagaaaacacgcttcagaagaacagaaggcc
acctatttgccaaagctggttacagaaaaattagggagcttttgcctctctgaagctgga
gccggtagcgactctttcgctatgaaaacaagagctgataaaagtggaaattactacgtc
ctcaatgggtcgaagatgtggatcagccatgccgagcatgcagagctcttcctggtcttc
gccaatgtggaccccagctctggctacagaggcatcacctgcttcttagtagaccgagat
acagaaggtttccagatagggaaacgagaaaataaaatgggcatcagagcttcatccacc
tgtcagttaacatttgaaaatgttaaggttccagagactaatattttggggaaaattggg
catggttataagtatgccataggaagtcttaatgaaggtagaatcggaattgctgcacag
atgctaggactggcccaaggatgttttgactacactattccatacattaaagaaaggatg
cagtttggcaaacgaatatttgattttcaggggctccaacaccaagtggctcaggtggcc
acccagctggaagccacacggttgctaacatacaacgctgctaggctcgtagaagccgga
aggccatttataaaagaagcatctatggccaaatattatgcatctgaggtcgctgggcta
acaacaagcaagtgcatcgagtggatgggaggggtcggctacaccaaagattaccctgtg
gagaaattcttccgagatgccaagatcggtacaatatatgaaggagcttccaacatccag
ctgaacaccatcgccaagcacatcgatgcagagtactga

DBGET integrated database retrieval system