KEGG   Mus musculus (mouse): 66890
Entry
66890             CDS       T01002                                 

Gene name
Lman2, 1110003H06Rik, 1300009F09Rik, AA408240, AL023023, AU040819, GP36, GP36B, VI, VIP36
Definition
(RefSeq) lectin, mannose-binding 2
  KO
K10082  lectin, mannose-binding 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    66890 (Lman2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    66890 (Lman2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    66890 (Lman2)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    66890 (Lman2)
Lectins [BR:mmu04091]
 L-type lectins
  66890 (Lman2)
SSDB
Motif
Pfam: Lectin_leg-like Bact_lectin
Other DBs
NCBI-GeneID: 66890
NCBI-ProteinID: NP_080104
MGI: 1914140
Ensembl: ENSMUSG00000021484
UniProt: Q9DBH5
Position
13; 13 B1
AA seq 358 aa
MAAEAWLWRWGWGWGQRCPGRPGLPGPGPSPTTFLHLLLLLGPVAADITDGNSEHLKREH
SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHF
KVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYIS
VMVNNGSLSYDHSKDGRWSELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKN
CIDITGVRLPTGYYFGASAGTGDLSDNHDIISIKLFQLTVERTPEEESIDWTKIEPGVNF
LKSPKDNVDDPTGNFRNGPLTGWRVFLLLLCALLGVVVCAVVGAVVFQKRQERNKRFY
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcggccgaggcctggctttggcgctggggctggggctggggtcagcggtgcccaggg
aggcctgggcttcctggccccggcccgagccccacgacatttctacatttgcttctgttg
ctggggccggtggctgcggatatcaccgacggcaacagcgaacacctcaagcgggagcac
tcgctcatcaagccctaccaaggggtcggttccagttccatgccgctctgggacttccaa
ggcagcacgatgctgacgagccagtacgtgcgcctgaccccggacgagcgcagcaaagag
ggctcgatctggaaccaccagccatgcttccttaaggactgggaaatgcacgtccacttc
aaagtccatggcacagggaagaagaacctccacggagatggcattgccttgtggtacacc
cgagaccgcctcgtaccagggcctgtgtttggaagcaaagacaacttccatggtttggcc
atcttcctggacacgtatcccaatgatgaaaccactgagcgtgtgttcccgtacatctcg
gtgatggtgaacaatggctctctgtcgtacgatcatagcaaagatggacgatggagtgag
ttggcaggctgcacggctgacttccgcaaccgggaccatgacaccttcctagctgtacgc
tattcccggggccgcctcacggtgatgactgacctggaagacaagaacgagtggaagaac
tgcattgacatcacaggggtgcgcctgcccactggctactactttggagcctctgctggc
accggcgacctgtctgacaaccacgacatcatctccatcaagctgttccagctcacggtg
gagcggacgcctgaggaggagagcatcgactggaccaagattgagcctggcgtcaatttc
ctcaagtcccccaaagacaatgtggacgaccccactggaaacttccgcaatgggcccctg
acaggatggagggtgttcctgctgctgctgtgcgcactcctgggcgttgtcgtctgtgct
gtggtgggcgctgtggtgtttcagaagcgccaggaacggaacaaacgtttctactga

DBGET integrated database retrieval system