KEGG   Mus musculus (house mouse): 668929
Entry
668929            CDS       T01002                                 
Symbol
Rad21l, Gm14160, MeiRAD21L, Rad21l1
Name
(RefSeq) RAD21-like (S. pombe)
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Rad21_Rec8_N Rad21_Rec8
Other DBs
NCBI-GeneID: 668929
NCBI-ProteinID: NP_001263329
MGI: 3652039
Ensembl: ENSMUSG00000074704
UniProt: A2AU37
Position
2:complement(151486286..151512542)
AA seq 552 aa
MFYTHVLMSKRGPLAKIWLAAHWEKKLTKAHVFECNLEITIQKIISPKVKIALRTSGHLL
LGVVRIYNRKAKYLLADCSEAFLKMKMTFRPGLVDLPKENFEAAYNTITLPEEFHDFEIY
NINEIDISEPLAQNQSRPEEITLREEYSNDLLFQAGSFGDEPEILRRHSFFDDNILMNSS
GLVVEHSSGSFAEEKSLFFDNGDGFGDEGAAGEMIDNLLQDESTFLEEAYLNKEVSLPPE
LPSSIMVEPGNSDDQCIPEDEEINEITLLSNEDEGFTLDPIDDLDIADRRRRKKRRLLVD
PVKEISSKAMHRQLASFMDTLMVLDLAPPTQRLMMWKKRGGVDMLLSTATQDLINDELKM
LFTKCFLSSDYKLAKLTLKESVRKEVGNQQIAEPSVMGEPNSHSELDQPQDWKDVTDESV
GSFQENVNMNVNSEQDILGMISPAVEGLSSMNGSLAQENCPAELESSGSKQNTEAEKWNQ
RLFQTLNVLREFNKMGMQSFSLKKLCRNSDRKQAAAKFYTLLILKKHRAIELSQSVPYAD
IIATVGPMFYKM
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgttctacactcatgtgcttatgagtaaacgggggccattggccaagatatggcttgca
gctcactgggagaagaaacttacaaaggcccatgtgttcgagtgtaatctagaaataacc
attcaaaaaattatttcacctaaggtgaaaattgcactccgaacttcaggacaccttctt
ttgggggttgttcgaatctacaacaggaaggcaaaataccttctggcagactgcagtgaa
gcattccttaagatgaagatgacatttcgcccaggactggttgacctccccaaagagaat
tttgaagcagcttacaacactatcacattaccagaagaatttcatgattttgaaatctac
aatataaatgagattgatatttcggagccccttgctcagaaccaaagtagaccagaggaa
atcacacttagagaagaatatagcaatgatctacttttccaagctgggagctttggggat
gaacctgaaatcctcagaagacatagcttctttgatgacaacatattaatgaactccagt
ggtcttgtagtcgaacatagttctggaagcttcgctgaggaaaaatctttgttctttgac
aatggagatggatttggagatgaaggagctgcaggagaaatgattgacaatctattgcaa
gatgagagtacctttttagaagaagcatatttgaacaaagaagtgtctctgcctcctgag
cttcccagtagtataatggtagaaccaggtaattcagatgaccaatgtatacctgaagat
gaagaaataaatgaaataacattattatcaaatgaagatgaaggatttactctggaccca
attgatgatttagatattgctgacaggaggagaaggaaaaagaggagattgctggtagat
ccagtcaaggagataagcagcaaggctatgcataggcagcttgcttcctttatggacact
ctcatggttctggaccttgcaccccccacacaaagattgatgatgtggaagaagcgggga
ggagtggatatgcttctgtcaactgctacccaggatttgattaatgacgaattgaaaatg
ttgtttacaaaatgcttcctgtcctctgactataaacttgcaaaattgacactgaaggag
tcagtaaggaaagaagtgggaaaccagcagattgcagaaccctcagtgatgggagagcca
aattcccacagtgagttagatcaaccccaagattggaaggatgtgactgatgaatctgtg
ggtagctttcaggagaacgtcaacatgaatgttaactctgagcaggatattcttggaatg
atttctccagctgttgagggattgtcttcaatgaatgggtccttggcccaagaaaattgt
ccagctgaattggagtcatcaggcagcaaacaaaatactgaggcagaaaaatggaatcaa
agattatttcaaacattaaatgtgttacgggaattcaacaaaatgggaatgcagtccttt
agtctgaaaaagctatgcagaaatagtgaccgaaaacaggcagctgccaaattttatact
cttctcatcctgaaaaaacatcgtgctattgagctgagccagagtgttccctatgcagat
attatagctacagtgggaccaatgttctataagatgtga

DBGET integrated database retrieval system