KEGG   Mus musculus (house mouse): 66904
Entry
66904             CDS       T01002                                 
Symbol
Pccb, 1300012P06Rik, AI314687, R74805
Name
(RefSeq) propionyl Coenzyme A carboxylase, beta polypeptide
  KO
K01966  propionyl-CoA carboxylase beta chain [EC:6.4.1.3 2.1.3.15]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Module
mmu_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    66904 (Pccb)
   00640 Propanoate metabolism
    66904 (Pccb)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    66904 (Pccb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     66904 (Pccb)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     66904 (Pccb)
SSDB
Motif
Pfam: Carboxyl_trans MdcE
Other DBs
NCBI-GeneID: 66904
NCBI-ProteinID: NP_080111
MGI: 1914154
Ensembl: ENSMUSG00000032527
UniProt: Q99MN9
Position
9:complement(100864085..100916993)
AA seq 541 aa
MAAAIRIRAVAAGARLSVLNCGLGITTRGLCSQPVSVKERIDNKRHAALLGGGQRRIDAQ
HKRGKLTARERISLLLDPGSFMESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRL
VYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYAD
IFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPEVVKSVTNED
VTQEQLGGAKTHTTVSGVAHRAFDNDVDALCNLREFFNFLPLSSQDPAPIRECHDPSDRL
VPELDTVVPLESSKAYNMLDIIHAVIDEREFFEIMPSYAKNIVVGFARMNGRTVGIVGNQ
PNVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYA
FAEATVPKITVITRKAYGGAYDVMSSKHLLGDTNYAWPTAEIAVMGAKGAVEIIFKGHQD
VEAAQAEYVEKFANPFPAAVRGFVDDIIQPSSTRARICCDLEVLASKKVHRPWRKHANIP
L
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggcggcggcgattaggattcgggcggtggcggctggagcgaggctcagcgttctgaat
tgcggcctcggcatcacgacccgcggcctttgcagccagccggtttcagttaaagagcgc
atcgacaacaagcgccatgcagcgttgctgggaggaggccagcgccgcatcgacgcgcag
cacaagcgagggaagctaacagccagggagcggatcagtcttctgctggatcctggcagc
ttcatggagagcgacatgtttgtggaacacagatgtgccgacttcggaatggctgctgat
aagaataagtttcccggagatagtgtggtcactggacggggccgaatcaatggacgattg
gtttatgtcttcagtcaggattttacagtttttggaggcagtctgtcaggagcacatgct
caaaagatctgcaaaatcatggaccaggccataacagtgggggctccagtgatcgggctc
aatgactccgggggcgccagaatccaggagggggtggagtccttggctggctacgcggac
atcttcctgaggaatgtcacagcgtctggagtcatcccgcagatttctctgatcatgggc
ccgtgtgctggtggggccgtctactcccctgccctaacagacttcacattcatggtgaag
gacacatcttacctgtttatcactggccctgaagttgtgaagtctgttaccaatgaggat
gtcactcaagagcagctgggtggtgccaagacccacaccactgtgtcaggtgtggcccat
agagctttcgacaatgatgttgatgctctgtgtaacctgcgtgaattcttcaatttcctg
cccctcagcagccaggacccggctcccatccgagagtgccatgaccccagtgaccgtctg
gttcctgagctggacacagttgtccctttggagtcaagcaaagcctacaacatgctggac
atcatccacgcagtgattgacgagagagagttttttgagataatgcccagttacgcaaaa
aatattgtcgttggcttcgcaagaatgaatgggaggaccgttggaattgtcggcaaccag
cccaatgtggcctcagggtgcttggacattaattcatccgtgaagggggctcgttttgtc
agattctgtgacgcattcaacattcccctcatcactttcgttgacgtccctggcttcctg
cctggcacggcgcaggagtatgggggcatcatcaggcatggtgccaagctgctctacgcg
ttcgccgaggcaactgtgcccaaaatcacagtcatcaccaggaaggcctatggaggtgcc
tatgatgtcatgagctccaaacaccttcttggtgacaccaactatgcctggcccacagct
gagattgcggtcatgggagcaaagggtgctgtggagatcatcttcaaaggacaccaagat
gtggaagccgcccaggcagagtatgtggagaagttcgccaaccctttcccagcagccgtg
agagggtttgtggatgacatcatccagccatcctctactcgtgctcggatatgctgtgac
ctggaagtcctggccagcaagaaggtccatcgtccctggaggaaacatgcaaatatccca
ctgtga

DBGET integrated database retrieval system