KEGG   Mus musculus (mouse): 66905
Entry
66905             CDS       T01002                                 

Symbol
Plin3, 1300012C15Rik, M6prbp1, Tip47
Name
(RefSeq) perilipin 3
  KO
K20287  perilipin-3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    66905 (Plin3)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    66905 (Plin3)
SSDB
Motif
Pfam: Perilipin Baculo_PEP_C Laminin_II
Other DBs
NCBI-GeneID: 66905
NCBI-ProteinID: NP_080112
MGI: 1914155
Ensembl: ENSMUSG00000024197
UniProt: Q9DBG5
Structure
Position
17:complement(56585962..56597511)
AA seq 437 aa
MSSNGTDAPAEAQAAMEEPVVQPSVVDRVAGLPLISSTYGMVSAAYTSTKENYPHVRTVC
DVAEKGVKTLTTAAVSTAQPILSKLEPQIATASEYAHRGLDRLQESLPILQQPTEKVLAD
TKELVSSTVSGAQEMVSSSVSSAKETVATRVTGAVDVTLGAVQNSVDKTKSAMTSGVQSV
MGSRVGQMVISGVDRVLVKSEAWADNRLPLTEAELALIATPPEDSDMASLQQQRQEQNYF
VRLGSLSERLRNHAYEHSLGKLQNARQKAQETLQQLTSVLGLMESVKQGVDQRLGEGQEK
LHQMWLSWNQKTPQDAEKDPAKPEQVEARALSMFRDITQQLQSMCVALGASIQGLPSHVR
EQAQQARSQVNDLQATFSGIHSFQDLSAGVLAQTRERIARAREALDNTVEYVAQNTPAMW
LVGPFAPGITEKTPEGK
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgtctagcaatggtacagatgcgcctgccgaagctcaagctgctatggaggaacctgtt
gtgcagcccagcgtggtggatcgtgttgccggcctgcctcttatcagttccacgtatggg
atggtgagcgccgcctacacctccaccaaggagaactacccccacgtcaggactgtgtgc
gatgtggctgagaaaggcgtcaagaccctcaccacggccgctgtcagcacagcacagccc
atcctgtccaagctggagccccagattgcgacggccagtgagtatgcacaccgagggctg
gacagactgcaggaaagcctgcccatcctccagcagccgactgagaaggttttggcggat
actaaggaactggtgtcatctacagtgtctggggctcaagaaatggtatctagctcagtg
tctagtgcgaaggaaacagtggccacccgggtcacaggagcggtggatgtgaccctcggg
gctgtgcagaacagcgtggacaagaccaagtcagcaatgaccagcggtgtccaatcagtc
atgggctcacgtgtgggacagatggtgattagcggagtggacagagtgcttgtgaaatca
gaggcctgggcagacaatcgcctgcccctgacagaggcggagctagctctgattgccaca
cccccggaggactcggacatggcctcactgcagcagcagcgacaggagcagaactacttt
gtccggttgggctctctctctgagaggctgcgcaatcacgcctatgaacactccctcggc
aagctgcagaatgccaggcagaaggcacaggagacgctgcagcagctaacaagtgtgctc
ggcctgatggaatccgtgaaacagggtgtggaccagaggctgggggaggggcaggagaag
ctgcaccagatgtggctcagctggaaccagaagaccccacaggatgctgaaaaggaccca
gctaagccagagcaggtggaggcccgggcactcagcatgttcagggacatcacccagcag
ctgcagagcatgtgtgtggccctgggggccagcatccagggcttgcccagccacgtcagg
gagcaggcacagcaggcccgcagccaggtgaacgaccttcaggccaccttctccggcatt
cactccttccaggacctctcagccggcgttcttgcccaaactcgggagcgcatagccaga
gcccgggaggccctagacaacactgtggagtacgtggcccagaacactccagccatgtgg
ctggtgggccccttcgctcctggaatcacagagaaaacccctgaagggaagtag

DBGET integrated database retrieval system