KEGG   Mus musculus (mouse): 66914Help
Entry
66914             CDS       T01002                                 

Gene name
Vps28, 1110014J03Rik, CIIA, D730005C08Rik
Definition
(RefSeq) vacuolar protein sorting 28
  KO
K12184  ESCRT-I complex subunit VPS28
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    66914 (Vps28)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    66914 (Vps28)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    66914 (Vps28)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    66914 (Vps28)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   66914 (Vps28)
  Exosomal proteins of other body fluids (saliva and urine)
   66914 (Vps28)
  Exosomal proteins of colorectal cancer cells
   66914 (Vps28)
  Exosomal proteins of bladder cancer cells
   66914 (Vps28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VPS28 RIG-I_C
Motif
Other DBs
NCBI-GeneID: 66914
NCBI-ProteinID: NP_080118
MGI: 1914164
Ensembl: ENSMUSG00000115987
UniProt: Q9D1C8
Position
15; 15 D3
AA seq 221 aa AA seqDB search
MFHGIPATPGVGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttccacgggatcccagctactcctggtgttggagcccctgggaacaagccggagctg
tatgaggaagtaaagctctacaagaatgctcgggagcgggagaagtatgacaacatggca
gagctctttgccgtggtgaagacgatgcaggccctggagaaggcgtacatcaaggactgt
gtcacccccaatgagtacactgcagcctgctccaggctcctggtccagtacaaagctgcc
ttccgacaggtccaaggctcagagatcagctccattgatgaattttgccgaaagttcaga
ctggactgcccacttgctatggagaggatcaaagaggaccggcccatcactatcaaagac
gacaagggcaatctcaaccgctgcattgcagatgttgtttcgctcttcattacagtcatg
gacaagctgcgtctggagatccgtgccatggacgagattcagccagacctgcgggagctg
atggagacaatgcacagaatgagccacctgcctccagacttcgagggccgccagacagtc
agccagtggctgcagaccctgagtggtatgtcggcctctgacgagctggatgactctcaa
gttcgccagatgctcttcgatctggagtccgcttacaacgcctttaaccgcttcctacac
gcctaa

DBGET integrated database retrieval system