KEGG   Mus musculus (mouse): 66926
Entry
66926             CDS       T01002                                 

Gene name
Trmt6, 3300001M20Rik, AU016412, AW492787, CGI-09, mKIAA1153
Definition
(RefSeq) tRNA methyltransferase 6
  KO
K03256  tRNA (adenine58-N1)-methyltransferase non-catalytic subunit
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    66926 (Trmt6)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    66926 (Trmt6)
SSDB
Motif
Pfam: Gcd10p INTS5_C Phage-scaffold
Other DBs
NCBI-GeneID: 66926
NCBI-ProteinID: NP_780322
MGI: 1914176
Ensembl: ENSMUSG00000037376
Vega: OTTMUSG00000015648
UniProt: Q8CE96
Position
2; 2 F2
AA seq 497 aa
MEASAAEQPSSPPPPLGDHCIHDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNAIG
HSYGSAFDVSSGGSLQLRKKLEEPASETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGI
KGEEIVQQLIENSTTFRDKTEFAQDKYIKKKKKKYEAIVTILKPSTRILSIMYYAREPGK
INHMRYDTLAQMLTLGNIRAGNKMIVMETCSGLVLGAMMERMGGFGSIIQLYPGDGPVRA
ATACFGFPKSFLSGLYEFPLNKVNSLLNGTFSAEMLSSEPKDSTPVEESNGELEEKEIAE
QADEDNIVDAAENNSGEQRPMEIVPGDPENKEPKEKRSKRDYIQEKQRRQEEQRKRHLEA
AALLGERNADGLIVASRFHPTPLLLSLLDFVAPSRPFVVYCQYKEPLLECYTKLRERGGV
INLRLSETWLRNYQVLPDRSHPKLLMSGGGGYLLSGFTVVSDSLRADPSLKSCTGALDPH
KAEEPAAKKQKCMESAS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggaggcatcagctgcggagcagccgagctcaccgcccccgcctctcggggaccactgc
atccatgacggtgacttcgtggtgctgaagcgagaagatgtgttcaaagcagtgcaagtc
cagcggagaaaaaaagtaacttttgaaaagcagtggttctacctggataacgccatcggc
catagttacggctcagcgtttgacgtgagcagtggaggcagccttcagctcaggaagaag
ctggaggagcccgcgtcagagaccaaagaagcaggcactgataatcgaaatatagttgat
gatggaaagtcccagaaacttactcaagatgatataaaagctctgaaagacaagggcatt
aaaggagaggaaatagttcagcagctaattgaaaatagtacaacattccgtgacaagaca
gaatttgcccaagataaatatattaaaaagaagaagaaaaaatatgaagccatcgttact
atcttgaagccatctacccgtattctttcaattatgtattatgcaagagaacctggaaaa
attaaccacatgagatatgatacactagcccagatgttgacgttgggaaatatccgtgcc
ggcaataaaatgattgtcatggaaacgtgctcgggcttggtgctaggtgccatgatggaa
cgaatgggaggctttggctccattattcagctgtatcctggagatggacccgttcgggcg
gcaacagcatgttttggatttcccaaatctttcctcagtggtctttacgagttccctctc
aacaaagtaaacagtctcctcaatgggacattttctgctgagatgctgtcctcagagcct
aaagacagcactccagttgaagaaagtaacggtgagcttgaggagaaagagattgctgaa
caagcggatgaagacaacattgtggatgccgcagaaaacaactcaggagaacagagacca
atggagattgttcctggggacccagagaataaggagcccaaagaaaaaagaagcaaaaga
gattatattcaggaaaagcaaaggagacaagaagagcagaggaaaagacatctggaggct
gctgctctgctgggagaaagaaatgcagatggtttgattgtggccagtcgtttccacccc
acgcccctgctgctgtctttgctggactttgtagccccgtcaaggccgtttgtggtctac
tgtcagtataaagagcctttgttggaatgctacacaaaacttcgggagaggggaggagtc
attaacctgaggttgtctgaaacctggctcagaaattaccaggttctgccagatcggagt
catcccaaattattgatgagtggcggtggagggtaccttctgtcagggttcactgttgtc
tcagacagccttcgggcagaccccagcctcaagtcctgcacaggcgctttagacccacac
aaggctgaggagccagcagctaaaaaacagaaatgcatggaatctgcctcttaa

DBGET integrated database retrieval system